Allergen |
Isoallergen / Isoform |
Epitope |
Type of Epitope |
Sequence Position |
View on Structure |
IEDB |
Antibody Used |
IMGT |
AgAbDb Link |
Nature of Epitope |
Assay |
Reference |
Comment |
Pis v 3 | Pis v 3.0101 | EQCAKGCEKYYKEKKGRE | Sequential / Linear | 51-68 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | MKQCERQDGGQQKQLCRFRCQEKYKKERREHSYS | Sequential / Linear | 105-134 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | TKRSKLLRGLEKYRLAFL | Sequential / Linear | 180-197 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | FFVSWGRGTITKIRENKRES | Sequential / Linear | 216-235 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | MNVKQGDIIRIRAGTPFYI | Sequential / Linear | 236-254 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | IVKASKEQIRAMSRRGE | Sequential / Linear | 324-340 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | GPSIWPFTGK | Sequential / Linear | 341-350 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | NITKGGMSGPFYNSRATK | Sequential / Linear | 393-410 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | KNSGQEKSGPSYKKLSSSIRTDSV | Sequential / Linear | 432-455 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |