Database of 2313 Experimentally Validated Allergens

Home About Browse Allergen Animal Plant Fungi Bacteria Virus IgE Epitopes Sequential (Linear) Conformational (Discontinuous) IgE Antibodies Specific Allergen Allergic Disease Asthma Rhinitis Dermatitis Allergen Category Respiratory Food Contact Non-specific   Search Basic Advanced BLAST Help

---

Sequential (Linear) IgE Epitopes Number of Records:  1134 Download data as Text file Allergen Isoallergen / Variant Epitope Type of Epitope Sequence Position View on Structure IEDB Antibody Used IMGT AgAbDb Link Nature of Epitope Assay Reference Comment Alt a 1 Alt a 1.0101 KISEFYGRKP Sequential / Linear 41-50 3V0R  4AUD   101790 IgE from serum of patients with Alternaria-induced allergy - - Major epitope Western / Immunoblot 12668200 - Alt a 1 Alt a 1.0101 YYNSLGFNIK Sequential / Linear 54-63 3V0R  4AUD   102271 IgE from serum of patients with Alternaria-induced allergy - - Major epitope Western / Immunoblot 12668200 - Alt a 1 Alt a 1.0101 YSCGENSFMD Sequential / Linear 87-96 3V0R  4AUD   102265 IgE from serum of patients with Alternaria-induced allergy - - - Western / Immunoblot 12668200 - Alt a 1 Alt a 1.0101 VATATLPNYC Sequential / Linear 119-128 3V0R  4AUD   102169 IgE from serum of patients with Alternaria-induced allergy - - - Western / Immunoblot 12668200 - Amb a 11 Amb a 11.0101 GKLVKFSEQQLVDC Sequential / Linear 173-186 5EF4  5EGW   1965359 IgE from serum of ragweed allergic patients - - - ELISA 35362839 - Amb a 3 Amb a 3.0101 GKVYLVGGPELGGWK Sequential / Linear 1-15 - 20726 IgE from serum of patients allergic to ragweed - - Immunodominant epitope Radio Immuno Assay 2410296 - Amb a 3 Amb a 3.0101 RAYALWSARQQFKTT Sequential / Linear 21-35 - 53247 IgE from serum of patients allergic to ragweed - - Immunodominant epitope Radio Immuno Assay 2410296 - Amb a 3 Amb a 3.0101 QFKTTDVLWFNFTTG Sequential / Linear 31-45 - 50795 IgE from serum of patients allergic to ragweed - - Immunodominant epitope Radio Immuno Assay 2410296 - Amb a 3 Amb a 3.0101 EVWREEAYHACDIKD Sequential / Linear 51-65 - 14906 IgE from serum of patients allergic to ragweed - - Immunodominant epitope Radio Immuno Assay 2410296 - Amb a 3 Amb a 3.0101 PGGPDRFTLLTPGSH Sequential / Linear 71-85 - 47669 IgE from serum of patients allergic to ragweed - - - Radio Immuno Assay 2410296 - Ana o 1 Ana o 1.0101 AIMGPPTKFSFSLFL Sequential / Linear - 2023 IgE from serum of cashew allergic patients - - Immunodominant epitope Radio Immuno Assay 12110836 - Ana o 1 Ana o 1.0101 TKIAIVVSGEGCVEI Sequential / Linear 407-421 - 64582 IgE from serum of cashew allergic patients - - Weakly binding epitope Radio Immuno Assay 12110836 - Ana o 1 Ana o 1.0101 SSHPSYKKLRARIRK Sequential / Linear 431-445 - 61072 IgE from serum of cashew allergic patients - - Weakly binding epitope Radio Immuno Assay 12110836 - Ana o 1 Ana o 1.0101 KECEKYYKEKKGRER Sequential / Linear 55-69 - 30318 IgE from serum of cashew allergic patients - - Immunodominant epitope Radio Immuno Assay 12110836 - Ana o 1 Ana o 1.0101 EEFFFQGPEWRKEKE Sequential / Linear 519-533 - 11615 IgE from serum of cashew allergic patients - - Immunodominant epitope Radio Immuno Assay 12110836 - Ana o 1 Ana o 1.0101 CKVQRQYDEQQKEQC Sequential / Linear 39-53 - 6532 IgE from serum of cashew allergic patients - - Weakly binding epitope Radio Immuno Assay 12110836 - Ana o 1 Ana o 1.0101 EQQKEQCVKECEKYY Sequential / Linear 47-61 - 13908 IgE from serum of cashew allergic patients - - Weakly binding epitope Radio Immuno Assay 12110836 - Ana o 1 Ana o 1.0101 EKKGREREHEEEEEE Sequential / Linear 63-77 - 12729 IgE from serum of cashew allergic patients - - Moderately binding epitope Radio Immuno Assay 12110836 - Ana o 1 Ana o 1.0101 DEAEEEDENPYVFED Sequential / Linear 143-157 - 7902 IgE from serum of cashew allergic patients - - Strongly binding epitope Radio Immuno Assay 12110836 - Ana o 1 Ana o 1.0101 RRGEGPKIWPFTEES Sequential / Linear 335-349 - 55567 IgE from serum of cashew allergic patients - - Moderately binding epitope Radio Immuno Assay 12110836 - Ana o 1 Ana o 1.0101 NITKGGMSVPFYNSR Sequential / Linear 391-405 - 44369 IgE from serum of cashew allergic patients - - Weakly binding epitope Radio Immuno Assay 12110836 - Ana o 2 Ana o 2.0101 SRQEWQQQDECQIDR Sequential / Linear 15-29 - 137576 IgE from pooled serum of cashew allergic patients - - Strongly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 QEWQQQDECQIDRLD Sequential / Linear 17-31 - 137555 IgE from pooled serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 QGEGMTGISYPGCPE Sequential / Linear 89-103 - 137556 IgE from pooled serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 QQGQSGRFQDRHQKI Sequential / Linear 113-127 - 137558 IgE from pooled serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 QDRHQKIRRFRRGDI Sequential / Linear 121-135 - 137554 IgE from pooled serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 AIPAGVAHWCYNEGN Sequential / Linear 137-151 - 137514 IgE from pooled serum of cashew allergic patients - - Moderately reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 LDRTPRKFHLAGNPK Sequential / Linear 169-183 - 137540 IgE from pooled serum of cashew allergic patients - - Moderately reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 RLIKQLKSEDNRGGI Sequential / Linear 217-231 - 137566 IgE from pooled serum of cashew allergic patients - - Moderately reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 LKWLQLSVEKGVLYK Sequential / Linear 313-327 - 137542 IgE from pooled serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 ALVLPHWNLNSHSII Sequential / Linear 329-343 - 137516 IgE from pooled serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 LNSHSIIYGCKGKGQ Sequential / Linear 337-351 - 137544 IgE from pooled serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 YQAPQQGRQQGQSGR Sequential / Linear 105-119 - 137586 IgE from pooled serum of cashew allergic patients - - Strongly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 QNFAVVKRAREERFE Sequential / Linear 377-391 - 137557 IgE from pooled serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 AREERFEWISFKTND Sequential / Linear 385-399 - 137519 IgE from pooled serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 PEEVLANAFQISRED Sequential / Linear 417-431 - 137551 IgE from pooled serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 QQGRQ Sequential / Linear 109-113 - 2187080 IgE from pooled serum of cashew allergic patients - - - Phage ELISA 36838874 - Ana o 2 Ana o 2.0101 QGQSGRF Sequential / Linear 114-120 - 2187067 IgE from pooled serum of cashew allergic patients - - - Phage ELISA 36838874 - Ana o 2 Ana o 2.0101 PKDVFQ Sequential / Linear 182-187 - 2187042 IgE from pooled serum of cashew allergic patients - - - Phage ELISA 36838874 - Ana o 2 Ana o 2.0101 IKQLKSE Sequential / Linear 219-225 - 2187080 IgE from pooled serum of cashew allergic patients - - - Phage ELISA 36838874 - Ana o 2 Ana o 2.0101 VFQQQQQHQSRGRNL Sequential / Linear 185-199 - 137579 IgE from pooled serum of cashew allergic patients - - Strongly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 KVKDDELRVIRPSRS Sequential / Linear 233-247 - 137539 IgE from pooled serum of cashew allergic patients - - Strongly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 VIRPSRSQSERGSES Sequential / Linear 241-255 - 137580 IgE from pooled serum of cashew allergic patients - - Strongly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 EESEDEKRRWGQRDN Sequential / Linear 257-271 - 137395 IgE from pooled serum of cashew allergic patients - - Strongly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 FQISREDARKIKFNN Sequential / Linear 425-439 - 137528 IgE from pooled serum of cashew allergic patients - - Strongly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 LSVCFLILFHGCLAS Sequential / Linear 1-15 - 137546 IgE from pooled serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 14555856 - Ana o 2 Ana o 2.0101 FHGCLASRQEWQQQD Sequential / Linear 9-23 - 137527 IgE from pooled serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 14555856 - Ana o 3 Ana o 3.0101 SGREQSCQRQFE Sequential / Linear 33-44 - 58215 IgE from serum of cashew allergic patients - - Strongly reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 RFRNCQRYVKQE Sequential / Linear 48-59 - 53773 IgE from serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 YNQRQESLRECC Sequential / Linear 66-77 - 75208 IgE from serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 RQESLRECCQEL Sequential / Linear 69-80 - 55412 IgE from serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 ECCQELQEVDRR Sequential / Linear 75-86 - 11234 IgE from serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 QELQEVDRRCRC Sequential / Linear 78-89 - 50648 IgE from serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 IKGEEVRELYET Sequential / Linear 105-116 - 26794 IgE from serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 ICSISPSQGCQF Sequential / Linear 123-134 - 25525 IgE from serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 AFAVLLLVANASIYRAIVEVE Sequential / Linear 10-30 - - IgE from cashew and tree-nut allergic patients - - Weakly reacting epitope Western / Immunoblot 26769082 - Ana o 3 Ana o 3.0101 RCRCQNLEQMVRQLQQQEQIKGE Sequential / Linear 85-108 - - IgE from cashew and tree-nut allergic patients - - Strongly reacting epitope Western / Immunoblot 26769082 - Ana o 3 Ana o 3.0101 CQRQFEEQQRFRNCQRYVKQEVQRGGRYNQRQE Sequential / Linear 39-71 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 1 Ana o 3 Ana o 3.0101 KQEVQRGGRYNQ Sequential / Linear 57-68 - 32975 IgE from serum of cashew allergic patients - - Strongly reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 SLRECCQELQEVDRRCR Sequential / Linear 72-88 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 1 Ana o 3 Ana o 3.0101 CQNLEQMVRQLQQQEQ Sequential / Linear 89-104 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 1 Ana o 3 Ana o 3.0101 YETASELPRICSISPSQG Sequential / Linear 114-131 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 1 Ana o 3 Ana o 3.0101 AFAVLLLVANASIYR Sequential / Linear 10-24 - 2186631 IgE from pooled serum of cashew allergic patients - - - Phage ELISA 36838874 - Ana o 3 Ana o 3.0101 VLLLVANASIYRAIV Sequential / Linear 13-27 - 2187257 IgE from pooled serum of cashew allergic patients - - - Phage ELISA 36838874 - Ana o 3 Ana o 3.0101 QRQFEEQQR Sequential / Linear 39-48 - 2187082 IgE from pooled serum of cashew allergic patients - - - Phage ELISA 36838874 - Ana o 3 Ana o 3.0101 YNQRQE Sequential / Linear 66-71 - 2187298 IgE from pooled serum of cashew allergic patients - - - Phage ELISA 36838874 - Ana o 3 Ana o 3.0101 QQEQIKG Sequential / Linear 101-107 - 2187079 IgE from pooled serum of cashew allergic patients - - - Phage ELISA 36838874 - Ana o 3 Ana o 3.0101 EEVRELYE Sequential / Linear 108-115 - 2186756 IgE from pooled serum of cashew allergic patients - - - Phage ELISA 36838874 - Ana o 3 Ana o 3.0101 TASELPRI Sequential / Linear 116-123 - 2187174 IgE from pooled serum of cashew allergic patients - - - Phage ELISA 36838874 - Ana o 3 Ana o 3.0101 SLRECCQELQEV Sequential / Linear 72-83 - 59430 IgE from serum of cashew allergic patients - - Strongly reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 QEQIKGEEVREL Sequential / Linear 102-113 - 50677 IgE from serum of cashew allergic patients - - Strongly reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 CQRQFEEQQRFR Sequential / Linear 39-50 - 6897 IgE from serum of cashew allergic patients - - Moderately reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 RYVKQEVQRGGR Sequential / Linear 54-65 - 56675 IgE from serum of cashew allergic patients - - Moderately reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 LQQQEQIKGEEV Sequential / Linear 99-110 - 38962 IgE from serum of cashew allergic patients - - Moderately reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 QFEEQQRFRNCQ Sequential / Linear 42-53 - 50752 IgE from serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 15940148 - Ana o 3 Ana o 3.0101 EQQRFRNCQRYV Sequential / Linear 45-56 - 13911 IgE from serum of cashew allergic patients - - Weakly reacting epitope Western / Immunoblot 15940148 - Ani s 1 Ani s 1.0101 ELFAREYEGVCKSGK Sequential / Linear 139-153 - 137145 IgE from serum of Anisakis-allergic patients - - Major epitope Fluorescence ELISA 20655337 - Ani s 1 Ani s 1.0101 RGSGWMMTILGKSCD Sequential / Linear 159-173 - 137278 IgE from serum of Anisakis-allergic patients - - Major epitope Fluorescence ELISA 20655337 - Ani s 5 Ani s 5.0101 LDAWVDTLGGDYKAKFETFK Sequential / Linear 58-77 2MAR   230150 Sera from Anisakis allergic patients - - - Microarray 24603892 - Ani s 5 Ani s 5.0101 AVAKMTPEAKKADAELSKIA Sequential / Linear 94-113 2MAR   230107 Sera from Anisakis allergic patients - - - Microarray 24603892 - Ani s 5 Ani s 5.0101 IQKAQKIQAIYKTLPQSVKD Sequential / Linear 121-140 2MAR   230137 Sera from Anisakis allergic patients - - - Microarray 24603892 - Ani s 7 Ani s 7.0101 MCQCVQKYGTEFCKKRLA Sequential / Linear 561-578 - 41204 Epitope recognized by monoclonal antibody (mAb) UA3 and Anisakis sensitized patient IgE - - Major epitope ELISA and Antigen Competition 18186812 - Api m 10 Api m 10.0101 ADSDVTTLPTLIGKN Sequential / Linear 179-193 - - Serum from Api m 10 sensitive patients - - Immunodominant epitope ImmunoCAP Test 31957885 - Ara h 1 Ara h 1.0101 AKSSPYQKKT Sequential / Linear 25-34 - 2286 IgE from serum of peanut allergic patients - - Immunodominant epitope Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 TPGQFEDFFP Sequential / Linear 294-303 3SMH  3S7I  3S7E   99029 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 SYLQGFSRNT Sequential / Linear 311-320 3SMH  3S7I  3S7E   99017 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 FNAEFNEIRR Sequential / Linear 325-334 3SMH  3S7I  3S7E   98775 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 EQEERGQRRW Sequential / Linear 344-353 - 98767 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 DITNPINLRE Sequential / Linear 393-402 3SMH  3S7I  3S7E   98731 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 NNFGKLFEVK Sequential / Linear 409-418 3SMH  3S7I  3S7E   98915 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 GTGNLELVAV Sequential / Linear 461-470 3SMH  3S7I  3S7E   98808 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 RRYTARLKEG Sequential / Linear 498-507 3SMH  3S7I  3S7E   55787 IgE from serum of peanut allergic patients - - Immunodominant epitope Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 ELHLLGFGIN Sequential / Linear 525-534 3SMH  3S7I  3S7E   98758 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 HRIFLAGDKD Sequential / Linear 539-548 3SMH  3S7I  3S7E   98815 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 QEPDDLKQKA Sequential / Linear 48-57 - 98953 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 IDQIEKQAKD Sequential / Linear 551-560 3SMH  3S7I  3S7E   98821 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 KDLAFPGSGE Sequential / Linear 559-568 3SMH  3S7I  3S7E   98842 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 KESHFVSARP Sequential / Linear 578-587 - 98844 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 PEKESPEKED Sequential / Linear 597-606 - 98927 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 SATHAKSSPYQKKT Sequential / Linear 21-34 - - IgE from serum of patients with peanut hypersensitivity - - Immunodominant epitope ELISA DOI:10.1080/09540100802172599 - Ara h 1 Ara h 1.0101 GERTRGRQPG Sequential / Linear 89-98 - - IgE from serum of patients with peanut hypersensitivity - - Immunodominant epitope ELISA DOI:10.1080/09540100802172599 - Ara h 1 Ara h 1.0101 DITNPINLREG Sequential / Linear 393-403 3SMH  3S7I  3S7E   - IgE from serum of patients with peanut hypersensitivity - - Immunodominant epitope ELISA DOI:10.1080/09540100802172599 - Ara h 1 Ara h 1.0101 RRYTARLKEG Sequential / Linear 498-507 3SMH  3S7I  3S7E   - IgE from serum of patients with peanut hypersensitivity - - Immunodominant epitope ELISA DOI:10.1080/09540100802172599 - Ara h 1 Ara h 1.0101 KESPEKEDQEEE Sequential / Linear 598-610 - - IgE from serum of patients with peanut hypersensitivity - - Immunodominant epitope ELISA DOI:10.1080/09540100802172599 - Ara h 1 Ara h 1.0101 LEYDPRCVYD Sequential / Linear 65-74 - 98871 IgE from serum of peanut allergic patients - - Immunodominant epitope Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 GERTRGRQPG Sequential / Linear 89-98 - 98795 IgE from serum of peanut allergic patients - - Immunodominant epitope Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 PGDYDDDRRQ Sequential / Linear 97-105 - 98931 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 PRREEGGRWG Sequential / Linear 107-116 - 98942 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 REREEDWRQP Sequential / Linear 123-132 - 98981 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 EDWRRPSHQQ Sequential / Linear 134-143 - 98746 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 1 Ara h 1.0101 QPRKIRPEGR Sequential / Linear 143-152 - 98966 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9151961 - Ara h 15 Ara h 15.0101 DKARDVKDRAKDYAG Sequential / Linear 151-155 - 165448 IgE from serum of Peanut-allergic patient - - Strongly binding epitope Microarray 28342912 - Ara h 15 Ara h 15.0101 SDQTRTGY Sequential / Linear 2-9 - 169691 IgE from Peanut-allergic patients - - - ELISA,MS 22790944 Buckwheat cross-reactive epitope Ara h 2 Ara h 2.0101 HASARQQWEL Sequential / Linear 18-27 - 23562 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9186485 - Ara h 2 Ara h 2.0101 QRCDLDVE Sequential / Linear 146-153 - 52191 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9186485 - Ara h 2 Ara h 2.0101 RDPYSPSQDPYSPS Sequential / Linear 62-75 - 157833 IgE from Peanut-allergic patients - - - Western / Immunoblot 21883278 - Ara h 2 Ara h 2.0101 EDSYERDPYSPSQDPY Sequential / Linear 57-72 - 2151233 IgE from Peanut-allergic patients - - - Dot blot 36527758 - Ara h 2 Ara h 2.0101 PYSPSQDPYSPSPYDR Sequential / Linear 64-79 - 2151250 IgE from Peanut-allergic patients - - - Dot blot 36527758 - Ara h 2 Ara h 2.0101 DRRGAGSSQHQERCCN Sequential / Linear 90-105 - 2151232 IgE from Peanut-allergic patients - - - Dot blot 36527758 - Ara h 2 Ara h 2.0101 ENNQRCMCEALQQIME Sequential / Linear 111-126 - 2151235 IgE from Peanut-allergic patients - - - Dot blot 36527758 - Ara h 2 Ara h 2.0101 QQFKRELRNLPQQCGL Sequential / Linear 139-154 - 2151253 IgE from Peanut-allergic patients - - - Dot blot 36527758 - Ara h 2 Ara h 2.0101 QWELQGDR Sequential / Linear 24-31 - 52829 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9186485 - Ara h 2 Ara h 2.0101 DRRCQSQLER Sequential / Linear 30-39 - 10040 IgE from serum of peanut allergic patients - - Immunodominant epitope Western / Immunoblot 9186485 - Ara h 2 Ara h 2.0101 LRPCEQHLMQ Sequential / Linear 42-51 - 39156 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9186485 - Ara h 2 Ara h 2.0101 KIQRDEDS Sequential / Linear 52-59 - 31404 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9186485 - Ara h 2 Ara h 2.0101 RDPYSP Sequential / Linear 62-67 - 73754 IgE from serum of peanut allergic patients - - Immunodominant epitope Western / Immunoblot 9186485 - Ara h 2 Ara h 2.0101 SQDPYSPS Sequential / Linear 68-75 - 60413 IgE from serum of peanut allergic patients - - Immunodominant epitope Western / Immunoblot 9186485 - Ara h 2 Ara h 2.0101 LQGRQQ Sequential / Linear 120-125 - 10012 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9186485 - Ara h 2 Ara h 2.0101 KRELRN Sequential / Linear 130-135 - 33122 IgE from serum of peanut allergic patients - - - Western / Immunoblot 9186485 - Ara h 3 Ara h 3.0101 IETWNPNNQEFECAG Sequential / Linear 30-44 3C3V   25997 IgE from serum of peanut allergic patients - - - Western / Immunoblot 10021462 - Ara h 3 Ara h 3.0101 RQQDRRRGRGSR Sequential / Linear 336-350 - 106086 IgE from serum of peanut allergic patients - - - Western / Immunoblot 18995911 GenBank Protein: AAM46958.1 Ara h 3 Ara h 3.0101 ICTASFKKNIGRNRSPDIYNP Sequential / Linear 357-371 - 105872 IgE from serum of peanut allergic patients - - - Western / Immunoblot 18995911 GenBank Protein: AAM46958.1 Ara h 3 Ara h 3.0101 PREQARQLKNNNPFKFFVPPSEQS Sequential / Linear 510-533 - 106008 IgE from serum of peanut allergic patients - - - Western / Immunoblot 18995911 GenBank Protein: AAM46958.1 Ara h 3 Ara h 3.0101 YEYDEEDRRR Sequential / Linear 304-313 - 693201 mAbs P1 and P2 - - - SPOT assay, ELISA 28800361 - Ara h 3 Ara h 3.0101 GNIFSGFTPEFLEQA Sequential / Linear 237-251 - 21443 IgE from serum of peanut allergic patients - - - Western / Immunoblot 10021462 - Ara h 3 Ara h 3.0101 VTVRGGLRILSPDRK Sequential / Linear 276-290 3C3V   71559 IgE from serum of peanut allergic patients - - Immunodominant epitope Western / Immunoblot 10021462 - Ara h 3 Ara h 3.0101 DEDEYEYDEEDRRRG Sequential / Linear 300-314 3C3V   7932 IgE from serum of peanut allergic patients - - - Western / Immunoblot 10021462 - Ara h 3 Ara h 3.0101 ALSRLVLRRNALRRP Sequential / Linear 46-60 3C3V   2894 IgE from serum of peanut allergic patients - - - Western / Immunoblot 18995911 GenBank Protein: AAM46958.1 Ara h 3 Ara h 3.0101 EPAQQGRRHQSQRPP Sequential / Linear 114-128 3C3V   105757 IgE from serum of peanut allergic patients - - - Western / Immunoblot 18995911 GenBank Protein: AAM46958.1 Ara h 3 Ara h 3.0101 LRYQQQSRRRSLPYS Sequential / Linear 207-221 - 105940 IgE from serum of peanut allergic patients - - - Western / Immunoblot 18995911 GenBank Protein: AAM46958.1 Ara h 3 Ara h 3.0101 REFSPRGQHGRR Sequential / Linear 234-248 - 106057 IgE from serum of peanut allergic patients - - - Western / Immunoblot 18995911 GenBank Protein: AAM46958.1 Ara h 3 Ara h 3.0101 GGLRILSPDRKR Sequential / Linear 300-311 3C3V   105826 IgE from serum of peanut allergic patients - - - Western / Immunoblot 18995911 GenBank Protein: AAM46958.1 Ara h 6 Ara h 6.0101 DRQMVQHFKR Sequential / Linear 110-119 - 157172 IgE from Peanut-allergic patients - - - Western / Immunoblot 21883278 - Ara h 7 Ara h 7.0101 DDQCQRQLQR Sequential / Linear 42-51 - 157158 IgE from Peanut-allergic patients - - - Western / Immunoblot 21883278 - Ara h 7 Ara h 7.0101 EQRCCNELNR Sequential / Linear 96-105 - 157219 IgE from Peanut-allergic patients - - - Western / Immunoblot 21883278 - Ara h 9 Ara h 9.0101 LAPCIPFLTKGGAPPPACCS Sequential / Linear 34-53 - 2141111 IgE from serum of peach allergic patients - - - Microarray 35935018 - Ara h 9 Ara h 9.0101 TTADRQAACNCLKAAAGSLR Sequential / Linear 64-83 - 2143898 IgE from serum of peach allergic patients - - - Microarray 35935018 - Ara h 9 Ara h 9.0101 LNQGNAAALPGRCGVSIPYK Sequential / Linear 85-104 - 1861901 IgE from serum of peach allergic patients - - - Microarray 35935018 - Ara h 9 Ara h 9.0101 CGVSIPYKISTSTNCATIKF Sequential / Linear 97-116 - 2139083 IgE from serum of peach allergic patients - - - Microarray 35935018 - Ara h 9 Ara h 9.0201 LSCGQVNSALAPCIT Sequential / Linear 1-15 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Ara h 9 Ara h 9.0201 VNSALAPCITFLTKG Sequential / Linear 6-20 - - Sera of peanut allergic patients from USA - - - Microarray,Fluorescence immunoassay 36698378 - Ara h 9 Ara h 9.0201 APCITFLTKGGVPSG Sequential / Linear 11-25 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Ara h 9 Ara h 9.0201 FLTKGGVPSGPCCSG Sequential / Linear 16-30 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Ara h 9 Ara h 9.0201 GVPSGPCCSGVRGLL Sequential / Linear 21-35 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Ara h 9 Ara h 9.0201 PCCSGVRGLLGAAKT Sequential / Linear 26-40 - - Sera of peanut allergic patients from USA - - - Microarray,Fluorescence immunoassay 36698378 - Ara h 9 Ara h 9.0201 AACNCLKAAAGSLHG Sequential / Linear 46-60 - - Sera of peanut allergic patients from USA - - - Microarray,Fluorescence immunoassay 36698378 - Ara h 9 Ara h 9.0201 AAALPGRCGVSIPYK Sequential / Linear 66-80 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Ara h 9 Ara h 9.0201 GRCGVSIPYKISTST Sequential / Linear 71-85 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Ara h PNA - NIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVA Sequential / Linear 54-86 1BZW  1CIW  1CQ9  1CR7  1QF3  1RIR   1RIT  1V6I  1V6J  1V6K  1V6L  1V6M   1V6N  1V6O  2DH1  2DV9  2DVA  2DVB   2DVD  2DVF  2DVG  2PEL  2TEP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Ara h PNA - LGVSDTKGA Sequential / Linear 129-137 1BZW  1CIW  1CQ9  1CR7  1QF3  1RIR   1RIT  1V6I  1V6J  1V6K  1V6L  1V6M   1V6N  1V6O  2DH1  2DV9  2DVA  2DVB   2DVD  2DVF  2DVG  2PEL  2TEP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Ara h PNA - VDSVKTVPWNSVSGA Sequential / Linear 168-182 1BZW  1CIW  1CQ9  1CR7  1QF3  1RIR   1RIT  1V6I  1V6J  1V6K  1V6L  1V6M   1V6N  1V6O  2DH1  2DV9  2DVA  2DVB   2DVD  2DVF  2DVG  2PEL  2TEP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Ara h PNA - IYDSSTKTL Sequential / Linear 189-197 1BZW  1CIW  1CQ9  1CR7  1QF3  1RIR   1RIT  1V6I  1V6J  1V6K  1V6L  1V6M   1V6N  1V6O  2DH1  2DV9  2DVA  2DVB   2DVD  2DVF  2DVG  2PEL  2TEP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Ara h PNA - QVVDLKAKLPERVKF Sequential / Linear 213-227 1BZW  1CIW  1CQ9  1CR7  1QF3  1RIR   1RIT  1V6I  1V6J  1V6K  1V6L  1V6M   1V6N  1V6O  2DH1  2DV9  2DVA  2DVB   2DVD  2DVF  2DVG  2PEL  2TEP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Ara h PNA - ASGSLGGRQIHLIRSWSFTSTLITT Sequential / Linear 231-255 1BZW  1CIW  1CQ9  1CR7  1QF3  1RIR   1RIT  1V6I  1V6J  1V6K  1V6L  1V6M   1V6N  1V6O  2DH1  2DV9  2DVA  2DVB   2DVD  2DVF  2DVG  2PEL  2TEP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Asp f 1 Asp f 1.0101 WTCINQQLNP Sequential / Linear 30-39 - - IgE from serum of allergic bronchopulmonary aspergillosis patients - - - ELISA 9864052 - Asp f 1 Asp f 1.0101 PGPARVIYTY Sequential / Linear 143-152 - 47719 IgE from serum of allergic bronchopulmonary aspergillosis patients - - Immunodominant epitope ELISA 9864052 - Asp f 1 Asp f 1.0101 VIYTYPNKVF Sequential / Linear 148-157 - 69172 IgE from serum of allergic bronchopulmonary aspergillosis patients - - Immunodominant epitope ELISA 9864052 - Asp f 1 Asp f 1.0101 GIVAHQRGNQ Sequential / Linear 159-168 - 20469 IgE from serum of allergic bronchopulmonary aspergillosis patients - - - ELISA 9864052 - Asp f 1 Asp f 1.0101 NQGDLRLCSH Sequential / Linear 167-176 - 45557 IgE from serum of allergic bronchopulmonary aspergillosis patients - - Immunodominant epitope ELISA 9864052 - Asp f 1 Asp f 1.0101 KTNKWEDKRL Sequential / Linear 40-49 - - IgE from serum of allergic bronchopulmonary aspergillosis patients - - - ELISA 9864052 - Asp f 1 Asp f 1.0101 YNQAKAESNS Sequential / Linear 51-60 - - IgE from serum of allergic bronchopulmonary aspergillosis patients - - - ELISA 9864052 - Asp f 1 Asp f 1.0101 DGKTGSSTPH Sequential / Linear 67-76 - - IgE from serum of allergic bronchopulmonary aspergillosis patients - - - ELISA 9864052 - Asp f 1 Asp f 1.0101 WFTNGYDGNG Sequential / Linear 77-86 - - IgE from serum of allergic bronchopulmonary aspergillosis patients - - - ELISA 9864052 - Asp f 1 Asp f 1.0101 GRTPIKFGKA Sequential / Linear 91-100 - - IgE from serum of allergic bronchopulmonary aspergillosis patients - - - ELISA 9864052 - Asp f 1 Asp f 1.0101 CDRPPKHSQN Sequential / Linear 102-111 - - IgE from serum of allergic bronchopulmonary aspergillosis patients - - - ELISA 9864052 - Asp f 1 Asp f 1.0101 GKDDHYLLEF Sequential / Linear 114-123 - 20526 IgE from serum of allergic bronchopulmonary aspergillosis patients - - - ELISA 9864052 - Asp f 1 Asp f 1.0101 FPTFPDGHDY Sequential / Linear 123-132 - 17418 IgE from serum of allergic bronchopulmonary aspergillosis patients - - - ELISA 9864052 - Asp f 13 Asp f 13.0101 NSDASNTSPASAPNALTVAAINKSNARASFSNYGSVVD Sequential / Linear 286-323 - 45775 IgE from serum of patients allergic to A. fumigatus - - Immunodominant epitope Dot-blot, N-terminal sequencing and mass spectrometry 10677362 - Asp f 13 Asp f 13.0101 IFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSVYLMGLENLSGPAAVTARIKE Sequential / Linear 324-380 - - IgE from serum of patients allergic to A. fumigatus - - Immunodominant epitope Dot-blot, N-terminal sequencing and mass spectrometry 10677362 - Asp f 13 Asp f 13.0101 GLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNGNA Sequential / Linear 364-403 - 20819 IgE from serum of patients allergic to A. fumigatus - - Immunodominant epitope Dot-blot, N-terminal sequencing and mass spectrometry 10677362 - Asp f 2 Asp f 2.0101 ATQRRQI Sequential / Linear 58-64 - 106669 IgE from pooled serum of allergic aspergillosis patients - - Immunodominant epitope Western / Immunoblot 10225885 - Asp f 2 Asp f 2.0101 RKYFG Sequential / Linear 93-97 - 106780 IgE from pooled serum of allergic aspergillosis patients - - Immunodominant epitope Western / Immunoblot 10225885 - Asp f 2 Asp f 2.0101 HWR Sequential / Linear 138-140 - 106524 IgE from pooled serum of allergic aspergillosis patients - - Immunodominant epitope Western / Immunoblot 10225885 - Asp f 2 Asp f 2.0101 YTTRR Sequential / Linear 155-159 - 107034 IgE from pooled serum of allergic aspergillosis patients - - Immunodominant epitope Western / Immunoblot 10225885 - Asp f 2 Asp f 2.0101 ASDLM Sequential / Linear 181-185 - 106270 IgE from pooled serum of allergic aspergillosis patients - - Immunodominant epitope Western / Immunoblot 10225885 - Asp f 2 Asp f 2.0101 YHVP Sequential / Linear 189-192 - 107016 IgE from pooled serum of allergic aspergillosis patients - - Immunodominant epitope Western / Immunoblot 10225885 - Asp f 2 Asp f 2.0101 DHFAD Sequential / Linear 200-204 - 106336 IgE from pooled serum of allergic aspergillosis patients - - Immunodominant epitope Western / Immunoblot 10225885 - Asp f 2 Asp f 2.0101 ALEAYA Sequential / Linear 231-236 - 106248 IgE from pooled serum of allergic aspergillosis patients - - Immunodominant epitope Western / Immunoblot 10225885 - Asp f 2 Asp f 2.0101 THEGGQ Sequential / Linear 301-306 - 106904 IgE from pooled serum of allergic aspergillosis patients - - Immunodominant epitope Western / Immunoblot 10225885 - Asp f 3 Asp f 3.0101 VFSYIPWSEDK Sequential / Linear 15-25 - - IgE from serum of patients with allergic bronchopulmonary aspergillosis - - - ELISA 12173308 - Asp f 3 Asp f 3.0101 ACGIPINYNASKEWADKKVIL Sequential / Linear 30-50 - - IgE from serum of patients with allergic bronchopulmonary aspergillosis - - - ELISA 12173308 - Asp f 3 Asp f 3.0101 VCSARHVPEYI Sequential / Linear 60-70 - - IgE from serum of patients with allergic bronchopulmonary aspergillosis - - - ELISA 12173308 - Asp f 3 Asp f 3.0101 AVLAYNDAYVMSAWGK Sequential / Linear 85-100 - - IgE from serum of patients with allergic bronchopulmonary aspergillosis - - - ELISA 12173308 - Asp f 3 Asp f 3.0101 PDARFSKSIGW Sequential / Linear 115-125 - - IgE from serum of patients with allergic bronchopulmonary aspergillosis - - - ELISA 12173308 - Asp f 3 Asp f 3.0101 GRTKRYALVIDHGKIT Sequential / Linear 130-145 - - IgE from serum of patients with allergic bronchopulmonary aspergillosis - - - ELISA 12173308 - Asp f 3 Asp f 3.0101 EPAKNHLEFSSAETVL Sequential / Linear 150-165 - - IgE from serum of patients with allergic bronchopulmonary aspergillosis - - - ELISA 12173308 - Asp t 36 Asp t 36.0101 IGVAAQNVFDKPNGAFTGEIS Sequential / Linear 58-78 - - Pooled sera from A. terreus sensitive patients - - Immunodominant epitope ELISA 33082142 - Asp t 36 Asp t 36.0101 DWTLIGHSERRVILKESDEFIARKVK Sequential / Linear 88-113 - - Pooled sera from A. terreus sensitive patients - - Immunodominant epitope ELISA 33082142 - Asp t 36 Asp t 36.0101 AIGTGKVATTEQAQEVHAA Sequential / Linear 170-188 - - Pooled sera from A. terreus sensitive patients - - Immunodominant epitope ELISA 33082142 - Asp t 36 Asp t 36.0101 AKQPDVDGFLVGGASLKP Sequential / Linear 222-239 - - Pooled sera from A. terreus sensitive patients - - Immunodominant epitope ELISA 33082142 - Asp v 13 Asp v 13.0101 ALLPAVFGAPILEARRQTEKVPGK Sequential / Linear 13-36 - - IgE from serum of patients allergic to fungi - - - Western / Immunoblot 21632114 - Asp v 13 Asp v 13.0101 TTWASNVHKRNLERRDLTD Sequential / Linear 54-72 - - IgE from serum of patients allergic to fungi - - - Western / Immunoblot 21632114 - Asp v 13 Asp v 13.0101 IEKNFKIHKFAA Sequential / Linear 79-90 - - IgE from serum of patients allergic to fungi - - - Western / Immunoblot 21632114 - Asp v 13 Asp v 13.0101 GTIGGKTFGVSKKANLLS Sequential / Linear 199-216 - - IgE from serum of patients allergic to fungi - - - Western / Immunoblot 21632114 - Asp v 13 Asp v 13.0101 NWAANDIVSKSRTGKSAI Sequential / Linear 235-253 - - IgE from serum of patients allergic to fungi - - - Western / Immunoblot 21632114 - Asp v 13 Asp v 13.0101 LTVAASTERNAR Sequential / Linear 301-312 - - IgE from serum of patients allergic to fungi - - - Western / Immunoblot 21632114 - Ber e 1 Ber e 1.0101 QMQRQQMLSHCRMY Sequential / Linear 43-56 2LVF   51634 IgE from serum of Brazil nut allergic patient - - - ELISA 15465060 - Bet v 1 Bet v 1.0101 GDNLFPKVAPQAIS Sequential / Linear 27-40 1B6F  1BTV  1BV1  1FSK  1LLT  1QMR   4A80  4A81  4A83  4A84  4A85  4A86   4A87  4A88  4A8G  4B9R  4BK6  4BK7   4BKC  4BKD  4BTZ  4MNS  4QIP  4Z3L   196944 Recombinant human IgE from a combinatorial antibody fragment library - - - ELISA and Antigen Competition 24447087 - Bet v 1 Bet v 1.0101 ISFPEGFPFKYVKD Sequential / Linear 57-70 1B6F  1BTV  1BV1  1FSK  1LLT  1QMR   4A80  4A81  4A83  4A84  4A85  4A86   4A87  4A88  4A8G  4B9R  4BK6  4BK7   4BKC  4BKD  4BTZ  4MNS  4QIP  4Z3L   196955 Recombinant human IgE from a combinatorial antibody fragment library - - - ELISA and Antigen Competition 24447087 - Bet v 1 Bet v 1.0101 ILDGDNLFPKVAPQAI Sequential / Linear 24-39 1B6F  1BTV  1BV1  1FSK  1LLT  1QMR   4A80  4A81  4A83  4A84  4A85  4A86   4A87  4A88  4A8G  4B9R  4BK6  4BK7   4BKC  4BKD  4BTZ  4MNS  4QIP  4Z3L   26996 IgE from birch pollen-allergic patients - - - Antigen Competition,Hypersensitivity and Prausnitz-Kustner inhibition 7684629 Part of Haptenic epitope Bet v 1 Bet v 1.0101 EQVKASKEMGETLLRAVESYLLA Sequential / Linear 132-154 1B6F  1BTV  1BV1  1FSK  1LLT  1QMR   4A80  4A81  4A83  4A84  4A85  4A86   4A87  4A88  4A8G  4B9R  4BK6  4BK7   4BKC  4BKD  4BTZ  4MNS  4QIP  4Z3L   176804 Anti-Bet v 1 IgE from phage-display scFv hybrid library - - - ELISA and Immunoblot 23066955 E149 is critical for Ab-binding Bet v 1 Bet v 1.0101 DGDNLFPKVA Sequential / Linear 26-35 1B6F  1BTV  1BV1  1FSK  1LLT  1QMR   4A80  4A81  4A83  4A84  4A85  4A86   4A87  4A88  4A8G  4B9R  4BK6  4BK7   4BKC  4BKD  4BTZ  4MNS  4QIP  4Z3L   8363 IgE from pollen allergic patients - - - Competitive binding 2477335 - Bet v 1 Bet v 1.0101 ISFPEGFPFKYVK Sequential / Linear 57-69 1B6F  1BTV  4A80  4A81  4A83  4A84   4A85  4A86  4A87  4A88  4A8G  4B9R   4BK6  4BK7  4BKC  4BKD  4BTZ  4MNS   4QIP  4Z3L   767238 Monoclonal antibody 5B4 - - - Pepscan, Hydrogen / Deuterium exchange-MS 29171882 P59,E60,G61,F62,F64,K65 are critical for serum IgE binding Bet v 2 Bet v 2.0101 MSWQTYVDEHLMCDIDGQGEELAASAIVGHDG Sequential / Linear 1-32 - 78467 IgE from serum of profilin-allergic patients - - Major epitope Phage display / Immunopanning 9016715 - Bet v 2 Bet v 2.0101 VGHDGSVWAQSSSFPQFKPQ Sequential / Linear 28-47 1CQA   78553 IgE from serum of profilin-allergic patients - - Major epitope Phage display / Immunopanning 9016715 - Bet v 2 Bet v 2.0101 VWAQSSSFPQFKPQE Sequential / Linear 34-48 1CQA   78561 IgE from serum of profilin-allergic patients - - Major epitope Phage display / Immunopanning 9016715 - Bet v 2 Bet v 2.0101 AQSSSFPQFKPQEITGI Sequential / Linear 36-52 1CQA   78351 IgE from serum of profilin-allergic patients - - Major epitope Phage display / Immunopanning 9016715 - Bet v 2 Bet v 2.0101 IYEEPVTPGQCNMVVERLGDYLIDQGL Sequential / Linear 107-133 1CQA   78427 IgE from serum of profilin-allergic patients - - Major epitope Phage display / Immunopanning 9016715 - Bet v 2 Bet v 2.0101 PQFKPQ Sequential / Linear 42-47 1CQA   48996 Monoclonal antibody 4A6 IMGT/3Dstructure-DB - - Western blot 8939935 Monoclonal antibody from Mouse Bla g 4 Bla g 4.0101 CPAAANGHVIYVQLRLTWRRFHPKLGDKEMIQHYT Sequential / Linear 118-152 - 104526 IgE from serum of cockroach-allergic patients - - Major epitope ELISA 19290089 - Bla g 5 Bla g 5.0101 EDYRFQEGDWPNLKP Sequential / Linear 31-45 4Q5R   174085 IgE from serum of filarial-infected patients allergic to cockroach allergen Bla g 5.0101 - - - Western / Immunoblot and Antigen Competition 22541242 - Bla g 5 Bla g 5.0101 EIDGKQTHQSVAISRYLGKQ Sequential / Linear 56-75 4Q5R   174094 IgE from serum of filarial-infected patients allergic to cockroach allergen Bla g 5.0101 - - - Western / Immunoblot and Antigen Competition 22541242 - Bla g 5 Bla g 5.0101 YHYDADENSKQKKWDPLKKE Sequential / Linear 106-125 4Q5R   174324 IgE from serum of filarial-infected patients allergic to cockroach allergen Bla g 5.0101 - - - Western / Immunoblot and Antigen Competition 22541242 - Bla g 5 Bla g 5.0101 TKKFDEVVKANGGYLAAGKLTWADF Sequential / Linear 131-155 4Q5R   174296 IgE from serum of filarial-infected patients allergic to cockroach allergen Bla g 5.0101 - - - Western / Immunoblot and Antigen Competition 22541242 - Blo t 12 Blo t 12.0101 HTEPDDHHEKPTTQCTHEET Sequential / Linear 30-49 - - IgE from serum of asthmatic patients allergic to B. tropicalis - - - Inhibition ELISA 19226278 - Blo t 12 Blo t 12.0101 TEETHHSDDLIVHEGGKTYH Sequential / Linear 73-92 - - IgE from serum of asthmatic patients allergic to B. tropicalis - - - Inhibition ELISA 19226278 - Blo t 12 Blo t 12.0101 IICSKSGSLWYITVMPCSIG Sequential / Linear 111-130 2MFK   - IgE from serum of asthmatic patients allergic to B. tropicalis - - - Inhibition ELISA 19226278 - Blo t 13 Blo t 13.0101 STFKNTEIKFKLGEEFEED Sequential / Linear 54-72 - 956712 Sera from patients with allergy to HDM and sensitized to Blo t 13 - - - ELISA 31817065 - Blo t 13 Blo t 13.0101 DVVVTASVGDVTSVRTYKR Sequential / Linear 111-129 - 956534 Sera from patients with allergy to HDM and sensitized to Blo t 13 - - - ELISA 31817065 - Blo t 5 Blo t 5.0101 ELKRTDLNILERFNYE Sequential / Linear 93-108 2JMH  2JRK  2MEY   97456 IgE from serum of patients allergic to B.tropicalis extract - - Major epitope ELISA 18684949 - Bomb m 4 Bomb m 4.0101 QFRVIFTEQTVKLIN Sequential / Linear 99-113 - - Sera of patients allergic to Silkworm pupa - - - ELISA 35028994 - Bomb m 4 Bomb m 4.0101 MFFVYNREYNSVMTL Sequential / Linear 209-223 - - Sera of patients allergic to Silkworm pupa - - - ELISA 35028994 - Bomb m 4 Bomb m 4.0101 VSGYPQLFAWYIVPY Sequential / Linear 242-256 - - Sera of patients allergic to Silkworm pupa - - - ELISA 35028994 - Bos d 10 Bos d 10.0101 YQKFALPQYL Sequential / Linear 186-195 - 75506 IgE from serum of patients with persistent cow's milk allergy - - - Western / Immunoblot 12170271 - Bos d 10 Bos d 10.0101 VVRNANEEEYSIGS Sequential / Linear 58-71 - - Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis - - Minor epitope Western / Immunoblot 12373003 - Bos d 10 Bos d 10.0101 PQYLQYLYQGPIVL Sequential / Linear 108-121 - - Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis - - Minor epitope Western / Immunoblot 12373003 - Bos d 10 Bos d 10.0101 VLNPWDQVKR Sequential / Linear 120-129 - - Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis - - Minor epitope Western / Immunoblot 12373003 - Bos d 10 Bos d 10.0101 VPITPTLNREQL Sequential / Linear 132-143 - - Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis - - Minor epitope Western / Immunoblot 12373003 - Bos d 10 Bos d 10.0101 KPWIQPKTKV Sequential / Linear 206-215 - - Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis - - Minor epitope Western / Immunoblot 12373003 - Bos d 10 Bos d 10.0101 NMAINPSK Sequential / Linear 40-47 - - Serum of cow milk-allergic patients - - - Dot blot 36307246 - Bos d 10 Bos d 10.0101 KNTMEHVSSSEESIISQETYKQEKNMAINPSK Sequential / Linear 16-47 - 78187 IgE from serum of patients with cow's milk allergy - - - Microarray 18774394 - Bos d 10 Bos d 10.0101 EEVKITVDDKHYQKALNEIN Sequential / Linear 82-101 - 78138 IgE from serum of patients with cow's milk allergy - - - Microarray 18774394 - Bos d 10 Bos d 10.0101 KTVYQHQKAMKPWIQPKTKVIPYVRYL Sequential / Linear 196-222 - 78189 IgE from serum of patients with cow's milk allergy - - - Microarray 18774394 - Bos d 10 Bos d 10.0101 NEINQFYQKFPQYLQYLY Sequential / Linear 98-115 - - Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis - - Major epitope Western / Immunoblot 12373003 - Bos d 10 Bos d 10.0101 STEVFTKKTKLTEEEK Sequential / Linear 158-173 - - Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis - - Major epitope Western / Immunoblot 12373003 - Bos d 10 Bos d 10.0101 EKNRLNFLKKISQRYQ Sequential / Linear 172-187 - - Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis - - Major epitope Western / Immunoblot 12373003 - Bos d 10 Bos d 10.0101 KKISQRYQKFALPQYLKTVYQHQK Sequential / Linear 180-203 - - Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis - - Major epitope Western / Immunoblot 12373003 - Bos d 10 Bos d 10.0101 SKENLCSTFCKEVV Sequential / Linear 46-59 - - Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis - - Minor epitope Western / Immunoblot 12373003 - Bos d 11 Bos d 11.0101 INKKIEKFQSEEQQQTEDELQDKIH Sequential / Linear 41-65 - 78259 IgE from serum of patients with cow's milk allergy - - - Microarray 18774394 - Bos d 11 Bos d 11.0101 LQDKIHPFAQ Sequential / Linear 60-69 - - IgE from serum of children with cow's milk allergy - - Minor epitope Western / Immunoblot 11529896 - Bos d 11 Bos d 11.0101 QPLPPTVMFPPQSVLS Sequential / Linear 164-179 - - IgE from serum of children with cow's milk allergy - - Minor epitope Western / Immunoblot 11529896 - Bos d 11 Bos d 11.0101 QSKVLPVPQKAVPYPQRD Sequential / Linear 182-199 - - IgE from serum of children with cow's milk allergy - - Minor epitope Western / Immunoblot 11529896 - Bos d 11 Bos d 11.0101 FAQTQSLVYPFPGPIPNSLPQNI Sequential / Linear 67-89 - 78152 IgE from serum of patients with cow's milk allergy - - - Microarray 18774394 - Bos d 11 Bos d 11.0101 TVMFPPQSVLSLSQSKVLPV Sequential / Linear 169-188 - 78287 IgE from serum of patients with cow's milk allergy - - - Microarray 18774394 - Bos d 11 Bos d 11.0101 RELEELNVPGEIVE Sequential / Linear 16-29 - - IgE from serum of children with cow's milk allergy - - Major epitope Western / Immunoblot 11529896 - Bos d 11 Bos d 11.0101 TQSLVYPFPGPIPN Sequential / Linear 70-83 - - IgE from serum of children with cow's milk allergy - - Major epitope Western / Immunoblot 11529896 - Bos d 11 Bos d 11.0101 VVPPFLQPEV Sequential / Linear 98-107 - - IgE from serum of children with cow's milk allergy - - Major epitope Western / Immunoblot 11529896 - Bos d 11 Bos d 11.0101 KEMPFPKYPVEPFT Sequential / Linear 122-135 - - IgE from serum of children with cow's milk allergy - - Major epitope Western / Immunoblot 11529896 - Bos d 11 Bos d 11.0101 LPLPLLQSWM Sequential / Linear 150-159 - - IgE from serum of children with cow's milk allergy - - Major epitope Western / Immunoblot 11529896 - Bos d 11 Bos d 11.0101 MPIQAFLLYQEPVLGPVRGPFPII Sequential / Linear 200-223 - - IgE from serum of children with cow's milk allergy - - Major epitope Western / Immunoblot 11529896 - Bos d 12 Bos d 12.0101 KDERFFSDKI Sequential / Linear 34-43 - 30141 IgE from serum of patients with persistent cow's milk allergy - - - Western / Immunoblot 12170271 - Bos d 12 Bos d 12.0101 EAVESTVATLED Sequential / Linear 158-169 - - IgE from serum of children with cow's milk allergy - - Major epitope Western / Immunoblot 11529896 - Bos d 12 Bos d 12.0101 SPEVIESPPEINTVQVTS Sequential / Linear 170-187 - - IgE from serum of children with cow's milk allergy - - Major epitope Western / Immunoblot 11529896 - Bos d 12 Bos d 12.0101 SPPEINTVQV Sequential / Linear 176-185 - 60178 IgE from serum of patients with persistent cow's milk allergy - - - Western / Immunoblot 12170271 - Bos d 12 Bos d 12.0101 RYPSYGLNYYQQKPVALINN Sequential / Linear 55-74 - 78267 IgE from serum of patients with cow's milk allergy - - - Microarray 18774394 - Bos d 12 Bos d 12.0101 IRCEKDERFFSDKIAKYI Sequential / Linear 30-47 - - IgE from serum of children with cow's milk allergy - - Major epitope Western / Immunoblot 11529896 - Bos d 12 Bos d 12.0101 KIAKYIPIQYVLSRYPSYGLNYYQ Sequential / Linear 42-65 - - IgE from serum of children with cow's milk allergy - - Major epitope Western / Immunoblot 11529896 - Bos d 12 Bos d 12.0101 PVALINNQFLPYPYYAKPAAVR Sequential / Linear 68-89 - - IgE from serum of children with cow's milk allergy - - Major epitope Western / Immunoblot 11529896 - Bos d 12 Bos d 12.0101 VRSPAQILQWQV Sequential / Linear 88-99 - - IgE from serum of children with cow's milk allergy - - Major epitope Western / Immunoblot 11529896 - Bos d 12 Bos d 12.0101 MARHPHPHLSFMAIPPKKNQDK Sequential / Linear 116-137 - - IgE from serum of children with cow's milk allergy - - Major epitope Western / Immunoblot 11529896 - Bos d 12 Bos d 12.0101 PHLSFMAIPPKKNQDKTEIPTINTIA Sequential / Linear 122-147 - - IgE from serum of children with cow's milk allergy - - Major epitope Western / Immunoblot 11529896 - Bos d 4 Bos d 4.0101 KCEVFRELKDLKGY Sequential / Linear 24-37 1F6R  1F6S  1HFZ  2G4N   30052 IgE from serum of patients with cow's milk allergy - - - Radio Immuno Assay 1720415 - Bos d 4 Bos d 4.0101 INYWLAHKALCSEKL Sequential / Linear 120-134 1F6R  1F6S  1HFZ  2G4N   558436 IgE from serum of cow milk-allergic patients - - - ELISA 27603546 - Bos d 4 Bos d 4.0101 DDQNPHSSNICNISCDK Sequential / Linear 82-98 2G4N   - Serum of cow milk-allergic patients - - - Dot blot 36307246 - Bos d 4 Bos d 4.0101 FLDDDLTDDIMCVK Sequential / Linear 99-112 2G4N   - Serum of cow milk-allergic patients - - - Dot blot 36307246 - Bos d 4 Bos d 4.0101 EQLTKCEVFRELKDLK Sequential / Linear 20-35 1F6R  1F6S  1HFZ  2G4N   - IgE from serum of patients with cow's milk allergy - - - Western / Immunoblot 11729348 - Bos d 4 Bos d 4.0101 KDLKGYGGVSLPEW Sequential / Linear 32-45 1F6R  1F6S  1HFZ  2G4N   - IgE from serum of patients with cow's milk allergy - - - Western / Immunoblot 11729348 - Bos d 4 Bos d 4.0101 STEYGLFQINNK Sequential / Linear 66-77 1F6R  1F6S  1HFZ  2G4N   115498 IgE from serum of patients with cow's milk allergy - - - Western / Immunoblot 11729348 - Bos d 4 Bos d 4.0101 KKILDKVGIN Sequential / Linear 112-121 1F6R  1F6S  1HFZ  2G4N   115317 IgE from serum of patients with cow's milk allergy - - - Western / Immunoblot 11729348 - Bos d 4 Bos d 4.0101 EQLTKCEVFRELKDL Sequential / Linear 20-34 1F6R  1F6S  1HFZ  2G4N   558421 IgE from serum of cow milk-allergic patients - - - ELISA 27603546 - Bos d 4 Bos d 4.0101 CEVFRELKDLKGYGG Sequential / Linear 25-39 1F6R  1F6S  1HFZ  2G4N   558390 IgE from serum of cow milk-allergic patients - - - ELISA 27603546 - Bos d 4 Bos d 4.0101 DSTEYGLFQINNKIW Sequential / Linear 65-79 1F6R  1F6S  1HFZ  2G4N   558411 IgE from serum of cow milk-allergic patients - - - ELISA 27603546 - Bos d 4 Bos d 4.0101 NICNISCDKFLDDDL Sequential / Linear 90-104 1F6R  1F6S  1HFZ  2G4N   558465 IgE from serum of cow milk-allergic patients - - - ELISA 27603546 - Bos d 5 Bos d 5.0101 LIVTQTMKGLDIQKVA Sequential / Linear 17-32 1B8E  1BSO  1BSQ  1BSY  1QG5  1UZ2   2BLG  2Q2M  2Q2P  2Q39  3BLG  3NPO   3UEV  3UEX  4DQ4  4IB7  4IB8  4IB9   4IBA  4Y0P  4Y0Q   - IgE from serum of patients with cow's milk allergy - - - Western / Immunoblot 11729348 - Bos d 5 Bos d 5.0101 WENGECAQK Sequential / Linear 77-85 4LZU   - Serum from cow milk-allergic patient - - - Dot blot 36307246 - Bos d 5 Bos d 5.0101 VLVLDTDYK Sequential / Linear 108-116 4LZU   - Serum from cow milk-allergic patient - - - Dot blot 36307246 - Bos d 5 Bos d 5.0101 TPEVDDEALEK Sequential / Linear 141-151 4LZU   - Serum from cow milk-allergic patient - - - Dot blot 36307246 - Bos d 5 Bos d 5.0101 TPEVDDEALEKFDK Sequential / Linear 141-154 4LZU   - Serum from cow milk-allergic patient - - - Dot blot 36307246 - Bos d 5 Bos d 5.0101 ALPMHIR Sequential / Linear 158-164 4LZU   - Serum from cow milk-allergic patient - - - Dot blot 36307246 - Bos d 5 Bos d 5.0101 LLDAQSAPLRVYVEELKP Sequential / Linear 47-64 1B0O  1B8E  1BEB  1BSO  1BSQ  1BSY   1CJ5  1DV9  1GXA  1QG5  1UZ2  1YUP   2AKQ  2BLG  2GJ5  2Q2M  2Q2P  2Q39   2R56  3BLG  3KZA  3NPO  3PH5  3PH6   3UEU  3UEV  3UEW  3UEX  4DQ3  4DQ4   4GNY  4IB7  4IB8  4IB9  4IBA  4KII   4LZU  4LZV  4Y0P  4Y0Q  4Y0R   - IgE from serum of patients with cow's milk allergy - - - Western / Immunoblot 11729348 - Bos d 5 Bos d 5.0101 KPTPEGDLEILLQK Sequential / Linear 63-76 1B0O  1B8E  1BEB  1BSO  1BSQ  1BSY   1CJ5  1DV9  1GXA  1QG5  1UZ2  1YUP   2AKQ  2BLG  2GJ5  2Q2M  2Q2P  2Q39   2R56  3BLG  3KZA  3NPO  3PH5  3PH6   3UEU  3UEV  3UEW  3UEX  4DQ3  4DQ4   4GNY  4IB7  4IB8  4IB9  4IBA  4KII   4LZU  4LZV  4Y0P  4Y0Q  4Y0R   - IgE from serum of patients with cow's milk allergy - - - Western / Immunoblot 11729348 - Bos d 5 Bos d 5.0101 AQKKIIAEKTKI Sequential / Linear 83-94 1B0O  1B8E  1BEB  1BSO  1BSQ  1BSY   1CJ5  1DV9  1GXA  1QG5  1UZ2  1YUP   2AKQ  2BLG  2GJ5  2Q2M  2Q2P  2Q39   2R56  3BLG  3NPO  3PH5  3PH6  3UEU   3UEV  3UEW  3UEX  4DQ3  4DQ4  4GNY   4IB7  4IB8  4IB9  4IBA  4KII  4LZU   4LZV  4Y0P  4Y0Q  4Y0R   3985 IgE from serum of patients with cow's milk allergy - - - Western / Immunoblot 11729348 - Bos d 5 Bos d 5.0101 KTKIPAVFKIDA Sequential / Linear 91-102 1B0O  1B8E  1BEB  1BSO  1BSQ  1BSY   1CJ5  1DV9  1GXA  1QG5  1UZ2  1YUP   2AKQ  2BLG  2GJ5  2Q2M  2Q2P  2Q39   2R56  3BLG  3NPO  3PH5  3PH6  3UEU   3UEV  3UEW  3UEX  4DQ3  4DQ4  4GNY   4IB7  4IB8  4IB9  4IBA  4KII  4LZU   4LZV  4Y0P  4Y0Q  4Y0R   33732 IgE from serum of patients with cow's milk allergy - - - Western / Immunoblot 11729348 - Bos d 5 Bos d 5.0101 EVDDEALEKFDKALKALP Sequential / Linear 143-160 1B0O  1B8E  1BEB  1BSO  1BSQ  1BSY   1CJ5  1DV9  1GXA  1QG5  1UZ2  1YUP   2AKQ  2BLG  2GJ5  2Q2M  2Q2P  2Q39   2R56  3BLG  3NPO  3PH5  3PH6  3UEU   3UEV  3UEW  3UEX  4DQ3  4DQ4  4GNY   4IB7  4IB8  4IB9  4IBA  4KII  4LZU   4LZV  4Y0P  4Y0Q  4Y0R   - IgE from serum of patients with cow's milk allergy - - - Western / Immunoblot 11729348 - Bos d 5 Bos d 5.0101 KALPMHIRLSFNPTQL Sequential / Linear 157-172 1B0O  1BEB  1BSO  1BSQ  1BSY  1CJ5   1DV9  1GXA  1UZ2  1YUP  2AKQ  2BLG   2GJ5  2Q2M  2Q39  2R56  3BLG  3NPO   3PH5  3PH6  3UEU  3UEV  3UEW  3UEX   4DQ3  4DQ4  4GNY  4IB7  4IB8  4IB9   4IBA  4KII  4LZU  4LZV  4Y0P  4Y0Q   4Y0R   - IgE from serum of patients with cow's milk allergy - - - Western / Immunoblot 11729348 - Bos d 5 Bos d 5.0101 RTPEVDDEALE Sequential / Linear 140-150 1B0O  1B8E  1BEB  1BSO  1BSQ  1BSY   1CJ5  1DV9  1GXA  1QG5  1UZ2  1YUP   2AKQ  2BLG  2GJ5  2Q2M  2Q2P  2Q39   2R56  3BLG  3KZA  3NPO  3PH5  3PH6   3UEU  3UEV  3UEW  3UEX  4DQ3  4DQ4   4GNY  4IB7  4IB8  4IB9  4IBA  4KII   4LZU  4LZV  4Y0P  4Y0Q  4Y0R   56145 IgE from serum of patients with cow's milk allergy - - - Radio Immuno Assay 1720415 - Bos d 5 Bos d 5.0102 LQKWENDECAQKKIIAEKTK Sequential / Linear 74-93 - 78201 IgE from serum of patients with cow's milk allergy - - - Microarray 18774394 - Bos d 6 Bos d 6.0101 EYAV Sequential / Linear 363-366 4F5S  4JK4  3V03  4OR0   14979 IgE from serum of patients allergic to beef - - - Antigen Competition / Inhibition ELISA 12054661 - Bos d 6 Bos d 6.0101 LILNR Sequential / Linear 478-482 4F5S  4JK4  3V03  4OR0   36612 IgE from serum of patients allergic to beef - - - Antigen Competition / Inhibition ELISA 12054661 - Bos d 9 Bos d 9.0101 NENLLRFFVAPFPEVFGKEK Sequential / Linear 32-51 - 43705 IgE from serum of patients with cow's milk allergy - - Major epitope ELISA 11174208 - Bos d 9 Bos d 9.0101 ELSKDIGSES Sequential / Linear 54-63 - 13272 IgE from serum of patients with persistent cow's milk allergy - - - Western / Immunoblot 12170271 - Bos d 9 Bos d 9.0101 EEIVPNSVEQ Sequential / Linear 84-93 - 11704 IgE from serum of patients with persistent cow's milk allergy - - - Western / Immunoblot 11678861 - Bos d 9 Bos d 9.0101 MKEGIHAQQK Sequential / Linear 138-147 - 41811 IgE from serum of patients with persistent cow's milk allergy - - - Western / Immunoblot 12170271 - Bos d 9 Bos d 9.0101 NENLLRFFVAPFPE Sequential / Linear 32-45 - 43704 IgE from serum of patients with cow's milk allergy - - Major epitope Western / Immunoblot 12897753 - Bos d 9 Bos d 9.0101 FFVAPFPEVFGKEK Sequential / Linear 38-51 - 15931 IgE from serum of patients with cow's milk allergy - - Major epitope Western / Immunoblot 12897753 - Bos d 9 Bos d 9.0101 ERYLGYLEQLLRLK Sequential / Linear 104-117 - 14100 IgE from serum of patients with cow's milk allergy - - Major epitope Western / Immunoblot 12897753 - Bos d 9 Bos d 9.0101 LEIVPNSAEERL Sequential / Linear 124-135 - 35530 IgE from serum of patients with cow's milk allergy - - Major epitope Western / Immunoblot 12897753 - Bos d 9 Bos d 9.0101 NQELAYFYPELFRQ Sequential / Linear 154-167 - 45540 IgE from serum of patients with cow's milk allergy - - Major epitope Western / Immunoblot 12897753 - Bos d 9 Bos d 9.0101 YPSGAWYYVPLGTQ Sequential / Linear 174-187 - 75410 IgE from serum of patients with cow's milk allergy - - Major epitope Western / Immunoblot 12897753 - Bos d 9 Bos d 9.0101 YTDAPSFSDIPNPI Sequential / Linear 188-201 - 75991 IgE from serum of patients with cow's milk allergy - - Major epitope Western / Immunoblot 12897753 - Bos d 9 Bos d 9.0101 KEDVPSERYLGYLEQLLRLK Sequential / Linear 98-117 - 30334 IgE from serum of patients with cow's milk allergy - - Major epitope ELISA 11174208 - Bos d 9 Bos d 9.0101 FSDIPNPIGSENSE Sequential / Linear 194-207 - 17690 IgE from serum of patients with cow's milk allergy - - Major epitope Western / Immunoblot 12897753 - Bos d 9 Bos d 9.0101 FPEVFGKEKVNELSKDIGSESTE Sequential / Linear 43-65 - 78158 IgE from serum of patients with cow's milk allergy - - - Microarray 18774394 - Bos d 9 Bos d 9.0101 LNENLLRFFVAPFPEVFGKE Sequential / Linear 31-50 - 38207 IgE from serum of patients with cow's milk allergy - - Immunodominant epitope Fluorescence Immuno Assay and Antigen Competition 15541041 - Bos d 9 Bos d 9.0101 IGVNQELAYFYPELFRQFYQ Sequential / Linear 151-170 - 26341 IgE from serum of patients with cow's milk allergy - - Immunodominant epitope Fluorescence Immuno Assay and Antigen Competition 15541041 - Bos d 9 Bos d 9.0101 IKHQGLPQEVLNENL Sequential / Linear 21-35 - 190448 IgE from serum of patients with cow's milk allergy - - Immunodominant epitope ELISA 24035023 - Bos d 9 Bos d 9.0101 LPQEVLNENLLRFFV Sequential / Linear 25-40 - 190475 IgE from serum of patients with cow's milk allergy - - Immunodominant epitope ELISA 24035023 - Bos d 9 Bos d 9.0101 VEQKHIQKEDVPSER Sequential / Linear 91-105 - 190571 IgE from serum of patients with cow's milk allergy - - Immunodominant epitope ELISA 24035023 - Bos d 9 Bos d 9.0101 GIHAQQKEPMIGVNQ Sequential / Linear 141-155 - 190431 IgE from serum of patients with cow's milk allergy - - Immunodominant epitope ELISA 24035023 - Bos d 9 Bos d 9.0101 TQYTDAPSFSDIPNP Sequential / Linear 186-200 - 190562 IgE from serum of patients with cow's milk allergy - - Immunodominant epitope ELISA 24035023 - Bos d 9 Bos d 9.0101 NLLRFFVAPFPE Sequential / Linear 34-45 - - Alpha casein-specific mAb 1D5 - - - Dot blot, MALDI-TOF MS 28643898 Gly m 5 cross-reactive epitope Bos d 9 Bos d 9.0101 LEIVPNSAEERL Sequential / Linear 124-135 - 35530 IgE from serum of patients with cow's milk allergy - - Major epitope ELISA and Western / Immunoblot 11174208 - Bos d 9 Bos d 9.0101 YLGYLEQLLR Sequential / Linear 96-105 - - Alpha casein-specific mAb 1D5 - - - Dot blot, MALDI-TOF MS 28643898 Gly m 5 cross-reactive epitope Bos d 9 Bos d 9.0101 QLLRLKKYKVPQLE Sequential / Linear 112-125 - - Alpha casein-specific mAb 1D5 - - - Dot blot, MALDI-TOF MS 28643898 Gly m 5 cross-reactive epitope Bos d 9 Bos d 9.0101 RPKHPIKHQGLPQEVLNE Sequential / Linear 16-33 - - Alpha casein-specific mAb 1D5 - - - Dot blot, MALDI-TOF MS 28643898 Gly m 5 cross-reactive epitope Bos d 9 Bos d 9.0101 EDVPSER Sequential / Linear 99-105 - - Serum of cow milk-allergic patients - - - Dot blot 36307246 - Bos d 9 Bos d 9.0101 EGIHAQQK Sequential / Linear 140-147 - - Serum of cow milk-allergic patients - - - Dot blot 36307246 - Bos d 9 Bos d 9.0101 NQELAYFYPELFRQF Sequential / Linear 154-168 - 45541 IgE from serum of patients with cow's milk allergy - - Major epitope ELISA 11174208 - Bos d 9 Bos d 9.0101 YPSGAWYYVPLGTQYT Sequential / Linear 174-189 - 75411 IgE from serum of patients with cow's milk allergy - - Major epitope ELISA 11174208 - Bos d 9 Bos d 9.0101 YTDAPSFSDIPNPIGSENSEKT Sequential / Linear 188-209 - 75992 IgE from serum of patients with cow's milk allergy - - Major epitope ELISA 11174208 - Bos d 9 Bos d 9.0101 ELSKDIGSES Sequential / Linear 54-63 - 13272 IgE from serum of patients with cow's milk allergy - - Minor epitope ELISA 11174208 - Bos d 9 Bos d 9.0101 EEIVPNSVEQ Sequential / Linear 84-93 - 11704 IgE from serum of patients with cow's milk allergy - - Minor epitope ELISA 11174208 - Bos d 9 Bos d 9.0101 MKEGIHAQQK Sequential / Linear 138-147 - 41811 IgE from serum of patients with cow's milk allergy - - Minor epitope ELISA and Western / Immunoblot 11174208 - Bos d COL1A2 - IPGEFGLPGP Sequential / Linear 573-582 - 27850 IgE from serum of patients allergic to bovine gelatin - - Major epitope Antigen Competition 12373276 - Can f 6 Can f 6.0101 SDIKEKIEENGS Sequential / Linear 43-54 5X7Y   738246 Sera from Dog allergic children - - - ELISA 29207604 - Can f 6 Can f 6.0101 TKVNGKCT Sequential / Linear 76-83 5X7Y   738266 Sera from Dog allergic children - - - ELISA 29207604 - Can f 6 Can f 6.0101 KTEKDGE Sequential / Linear 91-97 5X7Y   738174 Sera from Dog allergic children - - - ELISA 29207604 - Can f 6 Can f 6.0101 NVNQEQEF Sequential / Linear 125-132 5X7Y   738216 Sera from Dog allergic children - - - ELISA 29207604 - Can f 6 Can f 6.0101 GRKPDVSPKVKEKF Sequential / Linear 139-152 5X7Y   738153 Sera from Dog allergic children - - - ELISA 29207604 - Can f 7 Can f 7.0101 TYSYLNKLPVKN Sequential / Linear 106-117 - 871379 Serum from Dog-allergic children - - - ELISA 30664181 - Can f 7 Can f 7.0101 PSIKLVVQW Sequential / Linear 120-128 - 871006 Serum from Dog-allergic children - - - ELISA 30664181 - Car i 4 Car i 4.0101 PHYSNAPQLVYI Sequential / Linear 88-99 - 157741 IgE from pooled serum of Pecan allergic patients - - Moderately reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 GRQQHKFGQCQL Sequential / Linear 28-39 - 157343 IgE from pooled serum of Pecan allergic patients - - Weakly reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 SQQGQRREFQQD Sequential / Linear 124-135 - 158291 IgE from pooled serum of Pecan allergic patients - - Weakly reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 GQRREFQQDRHQ Sequential / Linear 127-138 - 157340 IgE from pooled serum of Pecan allergic patients - - Weakly reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 QQDRHQKIRHFR Sequential / Linear 133-144 - 157808 IgE from pooled serum of Pecan allergic patients - - Weakly reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 QEYEQHRRQQQH Sequential / Linear 205-216 - 157770 IgE from pooled serum of Pecan allergic patients - - Weakly reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 NNVFSGFDAEFL Sequential / Linear 232-243 - 157725 IgE from pooled serum of Pecan allergic patients - - Weakly reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 FSGFDAEFLADA Sequential / Linear 235-246 - 157280 IgE from pooled serum of Pecan allergic patients - - Weakly reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 HSVVYALRGRAE Sequential / Linear 385-396 - 157381 IgE from pooled serum of Pecan allergic patients - - Weakly reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 PQNFAVVKRARD Sequential / Linear 421-432 - 157762 IgE from pooled serum of Pecan allergic patients - - Weakly reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 FAVVKRARDEGF Sequential / Linear 424-435 - 157228 IgE from pooled serum of Pecan allergic patients - - Weakly reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 EESQRQSQQGQR Sequential / Linear 118-129 - 157186 IgE from pooled serum of Pecan allergic patients - - Strongly reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 QRQSQQGQRREF Sequential / Linear 121-132 - 157812 IgE from pooled serum of Pecan allergic patients - - Strongly reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 REFQQDRHQKIR Sequential / Linear 130-141 - 157835 IgE from pooled serum of Pecan allergic patients - - Moderately reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 QGQQEYEQHRRQ Sequential / Linear 202-213 - 157773 IgE from pooled serum of Pecan allergic patients - - Moderately reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 EQHRRQQQHQQR Sequential / Linear 208-219 - 157218 IgE from pooled serum of Pecan allergic patients - - Strongly reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 FDAEFLADAFNV Sequential / Linear 238-249 - 157230 IgE from pooled serum of Pecan allergic patients - - Strongly reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 ERRQSRRGGRDD Sequential / Linear 304-315 - 157220 IgE from pooled serum of Pecan allergic patients - - Moderately reacting epitope Western / Immunoblot 21718052 - Car i 4 Car i 4.0101 LNAHSVVYALRG Sequential / Linear 382-393 - 157603 IgE from pooled serum of Pecan allergic patients - - Moderately reacting epitope Western / Immunoblot 21718052 - Cha o 2 Cha o 2.0101 KVVNGRTV Sequential / Linear 169-176 - - Monoclonal antibody (mAb) T27 - - - ELISA 26916996 Cross-reactive epitope Chi t 1 Chi t 1.0101 GVTHDQLNNFR Sequential / Linear 106-116 1ECA  1ECD  1ECN  1ECO   23169 IgE from serum of patients allergic to Chi t 1 - - - Radio Immuno Assay 2464134 - Chla n Trp - KMQAMKVDRENAQDL Sequential / Linear 7-21 - 1391868 Sera from scallop-sensitive patients - - - ELISA 33960998 - Chla n Trp - QDLAEQMEQKLKDTE Sequential / Linear 19-33 - 1391906 Sera from scallop-sensitive patients - - - ELISA 33960998 - Chla n Trp - NNYDTVNEQLQE Sequential / Linear 55-66 - 1391892 Sera from scallop-sensitive patients - - - ELISA 33960998 - Chla n Trp - KQITQLESDVGG Sequential / Linear 76-87 - 1391870 Sera from scallop-sensitive patients - - - ELISA 33960998 - Chla n Trp - ADESERNRKVLEGRS Sequential / Linear 120-134 - 1391810 Sera from scallop-sensitive patients - - - ELISA 33960998 - Chla n Trp - SNSYEERIDELEKQL Sequential / Linear 134-148 - 1391927 Sera from scallop-sensitive patients - - - ELISA 33960998 - Chla n Trp - KVLELEEELTVVGA Sequential / Linear 189-202 - 1391871 Sera from scallop-sensitive patients - - - ELISA 33960998 - Cla c 14 Cla c 14.0101 TDAVPQKLKAEDVAKLDIEKKS Sequential / Linear 257-278 - - IgE from pooled serum of C. cladosporioides-sensitized patients with bronchial asthma - - - Western / Immunoblot 21488999 - Coc n 1 Coc n 1.0101 MEGREKRVEEKAPRSPEDR Sequential / Linear 35-53 - - Pooled sera from Coconut pollen allergic patients - - Immunodominant epitope ELISA 33486354 - Coc n 1 Coc n 1.0101 FTTSARKNRPQF Sequential / Linear 409-420 - - Pooled sera from Coconut pollen allergic patients - - Immunodominant epitope ELISA 33486354 - Coc n 1 Coc n 1.0101 EEINGKKWKGEE Sequential / Linear 469-480 - - Pooled sera from Coconut pollen allergic patients - - Immunodominant epitope ELISA 33486354 - Cor a 1 Cor a 1.0101 YVLDGDKLLPKVAPQAL Sequential / Linear 23-39 - 76332 IgE from pollen allergic patients - - - Competitive binding 2477335 - Cor a 9 Cor a 9.0101 QRSEQDRHQKIRHFR Sequential / Linear 137-151 - 114553 IgE from pooled serum of walnut and hazelnut allergic patients - - Moderately reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 PQQQSQQGQRQGQGQ Sequential / Linear 121-135 - 114521 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 QRQGQGQSQRSEQDR Sequential / Linear 129-143 - 114552 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 GDIIALPAGVAHWCY Sequential / Linear 153-167 - 114352 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 DGDSPVVTVSLLHTN Sequential / Linear 169-183 - 114295 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 YANQLDENPRHFYLA Sequential / Linear 185-199 - 114680 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 IVKVEGRLQVVRPER Sequential / Linear 273-287 - 114425 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 RQEWERQERQERESE Sequential / Linear 289-293 - 114587 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 RQERESEQERERQRR Sequential / Linear 297-311 - 114586 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 ERERQRRQGGRGRDV Sequential / Linear 305-319 - 114325 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 GGRGRDVNGFEETIC Sequential / Linear 313-327 - 114359 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 NPDDEHQRQGQQQFG Sequential / Linear 201-215 - 114495 IgE from pooled serum of walnut and hazelnut allergic patients - - Strongly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 VLRWLQLSAERGDLQ Sequential / Linear 361-375 - 114655 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 RAESEGFEWVAFKTN Sequential / Linear 433-447 - 114559 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 AFQISREEARRLKYN Sequential / Linear 473-487 - 114258 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 ARRLKYNRQETTLVR Sequential / Linear 481-495 - 114268 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 QETTLVRSSRSSSER Sequential / Linear 489-503 - 114529 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 SRSSSERKRRSESEG Sequential / Linear 497-511 - 114618 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 QGQQQFGQRRRQQQH Sequential / Linear 209-223 - 114532 IgE from pooled serum of walnut and hazelnut allergic patients - - Moderately reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 FSGFDAEFLADAFNV Sequential / Linear 241-255 - 114342 IgE from pooled serum of walnut and hazelnut allergic patients - - Strongly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 QVVRPERSRQEWERQ Sequential / Linear 281-295 - 114558 IgE from pooled serum of walnut and hazelnut allergic patients - - Strongly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 MAKLILVSFSLCLLV Sequential / Linear 1-15 - 114467 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 CQIESWDHNDQQFQC Sequential / Linear 57-71 - 114283 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 PQYSNAPELIYIERG Sequential / Linear 89-103 - 114522 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cor a 9 Cor a 9.0101 LIYIERGRGITGVLF Sequential / Linear 97-111 - 114454 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Cra a 2 Cra a 2.0101 SGAGVYACDPEGYEVFKE Sequential / Linear 56-73 - 1641094 IgE from sera of Oyster-sensitive patients - - - Dot blot, ELISA 34664604 - Cra a 2 Cra a 2.0101 PLDATGEFIVSTRV Sequential / Linear 105-118 - 2145105 IgE from sera of Oyster-allergic patients - - - Dot blot,iELISA 36205062 - Cra a 2 Cra a 2.0101 YKRLVSAIKQLE Sequential / Linear 236-247 - 2145266 IgE from sera of Oyster-allergic patients - - - Dot blot,iELISA 36205062 - Cra a 2 Cra a 2.0101 PVIMDYHKVDKVEHPP Sequential / Linear 77-92 - 1640420 IgE from sera of Oyster-sensitive patients - - - Dot blot, ELISA 34664604 - Cra a 2 Cra a 2.0101 CDFGPQDKLGFDPLD Sequential / Linear 93-107 - 1636526 IgE from sera of Oyster-sensitive patients - - - Dot blot, ELISA 34664604 - Cra a 2 Cra a 2.0101 GRSHEGYPFPPVS Sequential / Linear 121-133 - 1637924 IgE from sera of Oyster-sensitive patients - - - Dot blot, ELISA 34664604 - Cra a 2 Cra a 2.0101 TDEQRKEMENKTI Sequential / Linear 134-146 - 1641532 IgE from sera of Oyster-sensitive patients - - - Dot blot, ELISA 34664604 - Cra a 2 Cra a 2.0101 TMTPEENQQLID Sequential / Linear 165-176 - 1641742 IgE from sera of Oyster-sensitive patients - - - Dot blot, ELISA 34664604 - Cra a 2 Cra a 2.0101 DKMLGDAGGYNGWPKA Sequential / Linear 185-200 - 1636755 IgE from sera of Oyster-sensitive patients - - - Dot blot, ELISA 34664604 - Cra a 2 Cra a 2.0101 QKGGDVGEVYKR Sequential / Linear 227-238 - 1640530 IgE from sera of Oyster-sensitive patients - - - Dot blot, ELISA 34664604 - Cra a 2 Cra a 2.0101 GEHTESVGGVYDISNKRR Sequential / Linear 306-323 - 1637670 IgE from sera of Oyster-sensitive patients - - - Dot blot, ELISA 34664604 - Cra a 4 Cra a 4.0101 KISIEDVEESRN Sequential / Linear 22-33 - 1558351 Sera from Oyster-allergic patients - - - ELISA 34338271 - Cra a 4 Cra a 4.0101 TGAGKEISESEF Sequential / Linear 64-75 - 1560554 Sera from Oyster-allergic patients - - - ELISA 34338271 - Cra a 4 Cra a 4.0101 TEAYKKDKVGF Sequential / Linear 80-90 - 1560537 Sera from Oyster-allergic patients - - - ELISA 34338271 - Cra a 4 Cra a 4.0101 TNKDRTIDED Sequential / Linear 107-116 - 1560631 Sera from Oyster-allergic patients - - - ELISA 34338271 - Cra a 4 Cra a 4.0101 NKHVPLKDIVSEWVKF Sequential / Linear 144-159 - 1559312 Sera from Oyster-allergic patients - - - ELISA 34338271 - Cra a Trp - KENAQDR Sequential / Linear 15-21 - 2116381 IgE from Oyster-sensitive patients - - - Dot blot,ELISA 35848932 - Cra a Trp - LAEKERYK Sequential / Linear 261-268 - 2116382 IgE from Oyster-sensitive patients - - - Dot blot,ELISA 35848932 - Cra a Trp - QQLRDTEEQKAKIEE Sequential / Linear 27-41 - 2116399 IgE from Oyster-sensitive patients - - - Dot blot,ELISA 35848932 - Cra a Trp - LTSLQKKHS Sequential / Linear 43-51 - 2116383 IgE from Oyster-sensitive patients - - - Dot blot,ELISA 35848932 - Cra a Trp - NEKYQECQTKMEEAEK Sequential / Linear 61-76 - 2116386 IgE from Oyster-sensitive patients - - - Dot blot,ELISA 35848932 - Cra a Trp - EIQSLNR Sequential / Linear 84-90 - 2116376 IgE from Oyster-sensitive patients - - - Dot blot,ELISA 35848932 - Cra a Trp - AARKLAITEV Sequential / Linear 165-174 - 2116370 IgE from Oyster-sensitive patients - - - Dot blot,ELISA 35848932 - Cra a Trp - RLEAAEAKVYE Sequential / Linear 182-192 - 2116400 IgE from Oyster-sensitive patients - - - Dot blot,ELISA 35848932 - Cra a Trp - QLSVVANNIKTL Sequential / Linear 196-207 - 2116398 IgE from Oyster-sensitive patients - - - Dot blot,ELISA 35848932 - Cra a Trp - SQREDSYEET Sequential / Linear 215-224 - 2116402 IgE from Oyster-sensitive patients - - - Dot blot,ELISA 35848932 - Cra g 1 Cra g 1.0101 IQLLEEDMERSEER Sequential / Linear 92-105 - - IgE from serum of subjects allergic to mollusks and crustaceans - - - ELISA DOI:10.1111/j.1365-2621.1998.tb15672.x - Cra g 1 Cra g 1.0102 TSLQKK Sequential / Linear 44-49 - 886613 IgE from pooled sera of Oyster allergic patients - - Immunodominant epitope ELISA 30807831 - Cra g 1 Cra g 1.0102 TKLEEAEKTASEAEQEI Sequential / Linear 69-85 - 886612 IgE from pooled sera of Oyster allergic patients - - Immunodominant epitope ELISA 30807831 - Cra g 1 Cra g 1.0102 MERSEERLQT Sequential / Linear 99-108 - 886606 IgE from pooled sera of Oyster allergic patients - - Immunodominant epitope ELISA 30807831 - Cra g 1 Cra g 1.0102 NNASEERTDVL Sequential / Linear 134-144 - 886608 IgE from pooled sera of Oyster allergic patients - - Immunodominant epitope ELISA 30807831 - Cra g 1 Cra g 1.0102 VQNDQASQREDSYEET Sequential / Linear 209-224 - 886615 IgE from pooled sera of Oyster allergic patients - - Immunodominant epitope ELISA 30807831 - Cra g AK - LKDKKTK Sequential / Linear 32-38 - 1853715 Sera of Oyster-allergic patients - - - ELISA 34837649 - Cra g AK - VEHP Sequential / Linear 88-91 - 1854983 Sera of Oyster-allergic patients - - - ELISA 34837649 - Cra g AK - GRSHE Sequential / Linear 121-125 - 1853115 Sera of Oyster-allergic patients - - - ELISA 34837649 - Cra g AK - VSTDEQRKDMEN Sequential / Linear 132-143 - 1855116 Sera of Oyster-allergic patients - - - ELISA 34837649 - Cra g AK - ELK Sequential / Linear 155-157 - 1852830 Sera of Oyster-allergic patients - - - ELISA 34837649 - Cra g AK - QLEKK Sequential / Linear 245-249 - 1854439 Sera of Oyster-allergic patients - - - ELISA 34837649 - Cra g AK - EHT Sequential / Linear 307-309 - 1852820 Sera of Oyster-allergic patients - - - ELISA 34837649 - Cra g SCP - LDADKDNKITPED Sequential / Linear 15-27 - 1852276 IgE from pooled sera - - Immunodominant epitope ELISA 34854091 - Cra g SCP - FDNTKW Sequential / Linear 53-58 - 1852214 IgE from pooled sera - - Immunodominant epitope ELISA 34854091 - Cra g SCP - QKDK Sequential / Linear 86-89 - 1852323 IgE from pooled sera - - Immunodominant epitope ELISA 34854091 - Cra g SCP - ENMDRPIQEQ Sequential / Linear 109-118 - 1852211 IgE from pooled sera - - Immunodominant epitope ELISA 34854091 - Cra g SCP - DDDQSK Sequential / Linear 164-169 - 1852198 IgE from pooled sera - - Immunodominant epitope ELISA 34854091 - Cry j 1 Cry j 1.0101 NGNATPQLTKNA Sequential / Linear 352-363 - 44035 IgE from pooled serum of Japanese cedar-allergic patients - - - Western / Immunoblot and Antigen Competition 16079500 - Cry j 2 Cry j 2.0101 KWVNGREI Sequential / Linear 169-176 - 34335 IgE from serum of patients with CJ pollinosis - - Major epitope ELISA and Antigen Competition 12580914 - Cry j 2 Cry j 2.0101 GRENSRAEVSYVHVNGAKFI Sequential / Linear 285-305 - 22022 IgE from serum of patients with CJ pollinosis - - - Inhibition ELISA 23504147 - Cry j 2 Cry j 2.0101 TYKNIRGTSATAAAIQLKCS Sequential / Linear 366-385 - 188551 IgE from serum of patients with CJ pollinosis - - - Inhibition ELISA 23504147 - Cuc m 2 Cuc m 2.0101 FLGGTKYMVI Sequential / Linear 66-75 - 16615 IgE from serum of melon allergic patients - - Major epitope Western / Immunoblot 17397911 - Cuc m 2 Cuc m 2.0101 AVIRGKKGSG Sequential / Linear 81-90 - 5385 IgE from serum of melon allergic patients - - Major epitope Western / Immunoblot 17397911 - Cuc m 2 Cuc m 2.0101 GITVKKTNQA Sequential / Linear 91-100 - 20468 IgE from serum of melon allergic patients - - Major epitope Western / Immunoblot 17397911 - Cuc m 2 Cuc m 2.0101 LGDYLIEQGL Sequential / Linear 122-131 - 36083 IgE from serum of melon allergic patients - - Major epitope Western / Immunoblot 17397911 - Cuc m 2 Cuc m 2.0101 YVDDHLMCDIDGNRL Sequential / Linear 8-20 - ( ! ) Deprecated: Function split() is deprecated in C:\wamp\www\AllerBase\PHP_codes\BrSeqEpi.php on line 606 Call Stack # Time Memory Function Location 1 0.0432 791368 {main}( ) ..\BrSeqEpi.php:0 76244 37997 IgE from serum of melon allergic patients - - Minor epitope Western / Immunoblot 17397911 - Cuc m 2 Cuc m 2.0101 SATFPAFRLEEIAAILKDFD Sequential / Linear 36-55 - ( ! ) Deprecated: Function split() is deprecated in C:\wamp\www\AllerBase\PHP_codes\BrSeqEpi.php on line 606 Call Stack # Time Memory Function Location 1 0.0432 791368 {main}( ) ..\BrSeqEpi.php:0 57012 12382 IgE from serum of melon allergic patients - - Minor epitope Western / Immunoblot 17397911 - Cuc m 2 Cuc m 2.0101 YDEPLTPGQCNMIVE Sequential / Linear 106-120 - ( ! ) Deprecated: Function split() is deprecated in C:\wamp\www\AllerBase\PHP_codes\BrSeqEpi.php on line 606 Call Stack # Time Memory Function Location 1 0.0432 791368 {main}( ) ..\BrSeqEpi.php:0 73542 65586 IgE from serum of melon allergic patients - - Minor epitope Western / Immunoblot 17397911 - Cup s 3 Cup s 3.0101 RYTVWAAGLPGGGKRLDQ Sequential / Linear 36-53 - - IgE from Cupressaceae pollen allergic patients - - - ELISA DOI:10.3390/allergies3010002 - Cup s 3 Cup s 3.0101 AAGTASARFWGRTGCTFD Sequential / Linear 62-79 - - IgE from Cupressaceae pollen allergic patients - - - ELISA DOI:10.3390/allergies3010002 - Cup s 3 Cup s 3.0101 CRNAYVDNCPATNYSKIFKNQCPQA Sequential / Linear 176-200 - - IgE from Cupressaceae pollen allergic patients - - - ELISA DOI:10.3390/allergies3010002 - Cur l 3 Cur l 3.0101 QGDAKKGANLFKTRC Sequential / Linear 5-19 - 108599 IgE from serum of Curvularia allergic patients - - - ELISA and Antigen Competition 19290623 - Cur l 3 Cur l 3.0101 TRCAQCHTLK Sequential / Linear 17-26 - 108666 IgE from serum of Curvularia allergic patients - - - ELISA and Antigen Competition 19290623 - Cur l 3 Cur l 3.0101 LKAGEGNKIGPE Sequential / Linear 25-36 - 108523 IgE from serum of Curvularia allergic patients - - - ELISA and Antigen Competition 19290623 - Cur l 3 Cur l 3.0101 TDANKQKGIEWNHDT Sequential / Linear 54-68 - 108649 IgE from serum of Curvularia allergic patients - - - ELISA and Antigen Competition 19290623 - Cur l 3 Cur l 3.0101 ENPKKYIPGTK Sequential / Linear 74-84 - 108345 IgE from serum of Curvularia allergic patients - - - ELISA and Antigen Competition 19290623 - Cur l 3 Cur l 3.0101 LKKPKDRNDLI Sequential / Linear 90-100 - 108525 IgE from serum of Curvularia allergic patients - - - ELISA and Antigen Competition 19290623 - Cur l ADH - MSNIPQEQW Sequential / Linear 1-9 - 147140 IgE from pooled serum of Curvularia-allergic patients - - - ELISA 21647452 - Cur l ADH - EKTGGPVEYKKIPVQKPGPDE Sequential / Linear 14-34 - 146883 IgE from pooled serum of Curvularia-allergic patients - - - ELISA 21647452 - Cur l ADH - AVNGDWPLPTKLPLVGGH Sequential / Linear 51-68 - 146786 IgE from pooled serum of Curvularia-allergic patients - - - ELISA 21647452 - Cur l ADH - LKESGVKPGQFAAIVGAGGGL Sequential / Linear 164-184 - 147092 IgE from pooled serum of Curvularia-allergic patients - - - ELISA 21647452 - Cyn d 1 Cyn d 1.0101 CRACYEIKCK Sequential / Linear 70-79 - 174069 IgE from serum of Bermuda grass pollen allergic patients - - Major epitope Western / Immunoblot 21985791 - Cyn d 1 Cyn d 1.0101 IAAYHFDLSG Sequential / Linear 101-110 - 174146 IgE from serum of Bermuda grass pollen allergic patients - - Major epitope Western / Immunoblot 21985791 - Cyn d 1 Cyn d 1.0101 HYLALLVKY Sequential / Linear 159-167 - 174145 IgE from serum of Bermuda grass pollen allergic patients - - Major epitope Western / Immunoblot 21985791 - Cyn d 1 Cyn d 1.0101 GNIVAVDIKP Sequential / Linear 172-181 - 174123 IgE from serum of Bermuda grass pollen allergic patients - - Major epitope Western / Immunoblot 21985791 - Cyn d 1 Cyn d 1.0201 QDDVIPEDWKPDTVYKSKIQF Sequential / Linear 224-244 - 104948 IgE from serum of Bermuda grass pollen allergic patients - - Major epitope Immunoblot and ELISA 19187539 - Cyn d 1 Cyn d 1.0201 EEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAG Sequential / Linear 121-170 - 104761 IgE from serum of Bermuda grass pollen allergic patients - - Major epitope Immunoblot and ELISA 19187539 - Dan re COL1A2 - MKGLRGHPGLQGMPGPNGPS Sequential / Linear 1009-1028 - 138792 IgE from serum of Fish allergic patients - - Major epitope ELISA 20827051 - Der f 14 Der f 14.0101 SPVTKRASLKIDSKK Sequential / Linear 56-70 - 60327 IgE from serum of mite allergic patients - - - Western / Immunoblot 7510559 - Der f 14 Der f 14.0101 DVELSLRSSDIA Sequential / Linear 104-115 - 10579 IgE from serum of mite allergic patients - - - Western / Immunoblot and Antigen Competition 7510559 - Der f 1 - SAYLAYRN Sequential / Linear 144-151 3RVV  3D6S   558178 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 GenBank: EU095368.1 Der f 1 - GCHGDTIP Sequential / Linear 169-176 3RVV  3D6S   558069 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 GenBank: EU095368.1 Der f 1 - AREQQCRRPNSQ Sequential / Linear 197-208 - 558007 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 GenBank: EU095368.1 Der f 1 - GSTQGVDY Sequential / Linear 277-284 - 558083 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 GenBank: EU095368.1 Der f 2 Der f 2.0101 DQVDVKDCANNEIKKVMVDGCHGSDPCII Sequential / Linear 18-46 1AHK  1AHM   9918 IgE from serum of mite sensitive atopic patients - - - Western / Immunoblot and Antigen Competition 9224967 - Der f 2 Der f 2.0101 IAT Sequential / Linear 138-140 1AHK  1AHM  1XWV  2F08  1WRF   96373 IgE from serum of mite sensitive atopic patients - - - Western / Immunoblot and Antigen Competition 9224967 - Der f 24 Der f 24.0101 MVHLTKTLRFINNPGFRKFYYGLQGYNKYGLY Sequential / Linear 1-32 - 913688 Serum from House dust mite allergic patients - - Immunodominant epitope ELISA,Dot-blot 31545417 - Der f 2 - KVMVDGCH Sequential / Linear 32-39 1AHK  1AHM  1XWV  2F08  1WRF   558105 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 GenBank: FJ436110.1 Der f 2 - LVKGQQYDIK Sequential / Linear 97-106 1AHK  1AHM  2F08  1WRF   558110 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 GenBank: FJ436110.1 Der f 2 - VTVKLIGD Sequential / Linear 123-130 1AHK  1AHM  2F08  1WRF   558207 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 GenBank: FJ436110.1 Der f 3 Der f 3.0101 KAKAGDCP Sequential / Linear 33-40 - - - - Strongly reacting epitope IgE specific assay 25345157 GenBank Protein: AAA99805.1 Der f 3 Der f 3.0101 HASGGEKIQVAEIYQHENYDSMTID Sequential / Linear 86-110 - - - - Strongly reacting epitope IgE specific assay 25345157 GenBank Protein: AAA99805.1 Der f 3 Der f 3.0101 LKTPMTLDQTNAKPVPLPPQGSDVKVG Sequential / Linear 118-144 - - - - Strongly reacting epitope IgE specific assay 25345157 GenBank Protein: AAA99805.1 Der f 3 Der f 3.0101 QEGSYSLP Sequential / Linear 156-163 - - - - Strongly reacting epitope IgE specific assay 25345157 GenBank Protein: AAA99805.1 Der f 3 Der f 3.0101 DVANGGVDSCQGDSGGPVVD Sequential / Linear 199-218 - - - - Strongly reacting epitope IgE specific assay 25345157 GenBank Protein: AAA99805.1 Der f 4 Der f 4.0101 DIHTRSGDEQQFRR Sequential / Linear 92-105 - 558037 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 - Der f 4 Der f 4.0101 QSGLGTNGHH Sequential / Linear 130-139 - 558167 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 - Der f 4 Der f 4.0101 SHPFIYHE Sequential / Linear 248-255 - 558180 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 - Der f 4 Der f 4.0101 ITNVFRNN Sequential / Linear 284-291 - 558094 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 - Der f 4 Der f 4.0101 VGPPTDQHGNI Sequential / Linear 378-388 - 558201 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 - Der f 4 Der f 4.0101 VGHDEFDAFVAYHI Sequential / Linear 506-519 - 558200 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 - Der f 5 - KKEEQRVK Sequential / Linear 121-128 - 558100 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 - Der f 7 Der f 7.0101 SILDP Sequential / Linear 173-177 3UV1   150884 IgE from serum of patients allergic to group 7 dust mite with bronchial asthma - - - Western / Immunoblot and Antigen Competition 21820178 - Der f 7 - MKVPDHAD Sequential / Linear 49-56 3UV1   558113 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 GenBank: FJ436108.1 Der f 7 - GELAMRNIEARGL Sequential / Linear 69-81 3UV1   558072 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 GenBank: FJ436108.1 Der f 7 - DLAYKLGD Sequential / Linear 117-124 3UV1   558039 Pooled sera from pediatric patients with D. farinae hypersensitivity - - - Microarray 27481284 GenBank: FJ436108.1 Der p 2 Der p 2.0101 VPGIDPNACHYMKC Sequential / Linear 82-95 1A9V  1KTJ   70304 IgE from human antiserum - - - Radio Immuno Assay and Antigen Competition 1720504 Residue V1 is modified by Acetylation Der p 24 Der p 24.0101 MVHLTKTLRFINNPGFRKFYYGLQGYNKYGLY Sequential / Linear 1-32 - 913688 Serum from House dust mite allergic patients - - Immunodominant epitope ELISA,Dot-blot 31139345 - Der p 5 Der p 5.0101 DRLMQRKDLDIFEQYNLEM Sequential / Linear 90-108 3MQ1   934949 Allergic serum - - - ELISA, Alanine scanning 30430936 - Der p 5 Der p 5.0102 EDKKHDYQNEFDFLLMERIHEQIK Sequential / Linear 20-43 - 874187 Rabbit IgG blocking antibody - - - ELISA 30622713 IgG epitope Der p 5 Der p 5.0102 IHEQIKKGELALFYLQEQ Sequential / Linear 38-55 3MQ1   874262 Rabbit IgG blocking antibody - - - ELISA 30622713 IgG epitope Der p 5 Der p 5.0102 LMQRKDLDIFEQYNLEMAKKS Sequential / Linear 92-112 3MQ1   - Rabbit IgG blocking antibody and IgE - - - ELISA 30622713 IgG and IgE epitope Der p 7 Der p 7.0101 DPIHYDKITEEINKAVDEAVAAIEKSETFD Sequential / Linear 18-47 3H4Z   969047 IgE from serum of house dust mite allergic patients - - - Dot blot, antigen inhibition 34220841 - Equ c IgG3 - DVLFTWYVDGTEV Sequential / Linear 177-189 - 225719 IgE from pooled serum of horse antivenom allergic patients - - - Western / Immunoblot 24334152 - Eri s HC - NSEVIQEAYTAQMTQTPSKIKSHFTGS Sequential / Linear 181-207 - 546744 IgE from serum of Roe allergic patients - - Immunodominant epitope Western / Immunoblot 27208437 - Eri s HC - CADGKYPDNRPHGYPLDRR Sequential / Linear 644-662 - 546721 IgE from serum of Roe allergic patients - - - Western / Immunoblot 27208437 - Eri s HC - FWWDDSHENHHIERKGENF Sequential / Linear 237-265 - 546728 IgE from serum of Roe allergic patients - - Immunodominant epitope Western / Immunoblot 27208437 - Eri s HC - IRDAIAHGYITAKDGSTISI Sequential / Linear 331-350 - 546739 IgE from serum of Roe allergic patients - - - Western / Immunoblot 27208437 - Eri s HC - GDVIESSTYSPNPQYYGAL Sequential / Linear 360-378 - 546731 IgE from serum of Roe allergic patients - - Immunodominant epitope Western / Immunoblot 27208437 - Eri s HC - TAHVMLGRQGDPHGKFDLPPG Sequential / Linear 381-401 - 546752 IgE from serum of Roe allergic patients - - - Western / Immunoblot 27208437 - Eri s HC - DNIFREHKDSLTPYTTQELE Sequential / Linear 423-442 - 546726 IgE from serum of Roe allergic patients - - - Western / Immunoblot 27208437 - Eri s HC - VTNNNGKEVS Sequential / Linear 501-510 - 546758 IgE from serum of Roe allergic patients - - - Western / Immunoblot 27208437 - Eri s HC - TVRAFAWPKYDNNGVEYSFNDGR Sequential / Linear 512-534 - 546756 IgE from serum of Roe allergic patients - - - Western / Immunoblot 27208437 - Eri s HC - DGEEDATVDGLHDSTSFNHYG Sequential / Linear 623-643 - 546725 IgE from serum of Roe allergic patients - - - Western / Immunoblot 27208437 - Eup s 1 - VHNLQKRLQTLENDLD Sequential / Linear 43-58 - - IgE from shrimp/crab-allergic patients sera - - - ELISA 37057995 - Eup s 1 - LNRRIQLLEEDLER Sequential / Linear 88-101 - - IgE from shrimp/crab-allergic patients sera - - - ELISA 37057995 - Eup s 1 - TKLAEASQAADESER Sequential / Linear 111-125 - - IgE from shrimp/crab-allergic patients sera - - - ELISA 37057995 - Eup s 1 - RSMLDEERMDA Sequential / Linear 133-143 - - IgE from shrimp/crab-allergic patients sera - - - ELISA 37057995 - Eup s 1 - LESQLKEARLLA Sequential / Linear 144-155 - - IgE from shrimp/crab-allergic patients sera - - - ELISA 37057995 - Eup s 1 - AEAGENKIVELEEEL Sequential / Linear 183-197 - - IgE from shrimp/crab-allergic patients sera - - - ELISA 37057995 - Eup s 1 - EQIKHLTHKLKTAE Sequential / Linear 223-236 - - IgE from shrimp/crab-allergic patients sera - - - ELISA 37057995 - Eup s 1 - LQKEVDRLEDELV Sequential / Linear 249-261 - - IgE from shrimp/crab-allergic patients sera - - - ELISA 37057995 - Eup s 1 - EKEKYKGITDELDQTFNEL Sequential / Linear 144-155 - - IgE from shrimp/crab-allergic patients sera - - - ELISA 37057995 - Exo m 1 Exo m 1.0101 VHNLQKRMQQLENDLDS Sequential / Linear 43-59 - 956741 Sera from Shrimp allergic patients - - - Dot blot 31707198 - Exo m 1 Exo m 1.0101 VAALNRRIQLLEEDLERSEER Sequential / Linear 85-105 - 956737 Sera from Shrimp allergic patients - - - Dot blot 31707198 - Exo m 1 Exo m 1.0101 ENRSLSDEERMDALENQLKEARFLAEEADRKYDE Sequential / Linear 131-164 - 956549 Sera from Shrimp allergic patients - - - Dot blot 31707198 - Exo m 1 Exo m 1.0101 ESKIVELEEELRVVG Sequential / Linear 187-201 - 14183 Sera from Shrimp allergic patients - - - Dot blot 31707198 - Exo m 1 Exo m 1.0101 ERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSE Sequential / Linear 243-280 - 956552 Sera from Shrimp allergic patients - - - Dot blot 31707198 - Fag e 1 - QNVNRPSR Sequential / Linear 360-367 - 16452 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 15310064 - Fag e 1 - KIRSEGGTIEVWDEE Sequential / Linear 44-58 - 111455 IgE from serum of buckwheat allergic patients - - Minor epitope Western / Immunoblot 19463732 GenBank Protein: BAO50870.1 Fag e 1 - MRVTVQPDSLSLPSYYSSPRLV Sequential / Linear 70-91 - 111571 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 19463732 GenBank Protein: BAO50870.1 Fag e 1 - DAHQPTRRVRKGDVVALP Sequential / Linear 136-153 - 111186 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 19463732 GenBank Protein: BAO50870.1 Fag e 1 - QGGSKEGKSQKLNS Sequential / Linear 197-210 - 111669 IgE from serum of buckwheat allergic patients - - Minor epitope Western / Immunoblot 19463732 GenBank Protein: BAO50870.1 Fag e 1 - ESDERGPIVKARKNMRQMVT Sequential / Linear 238-257 - 111260 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 19463732 GenBank Protein: BAO50870.1 Fag e 1 - NMRFRHNLGPRTEADIASRQAGRIHSVD Sequential / Linear 278-306 - 111592 IgE from serum of buckwheat allergic patients - - Minor epitope Western / Immunoblot 19463732 GenBank Protein: BAO50870.1 Fag e 1 - NAMLAPAWPLSGHRVFYVLRGEAQRQI Sequential / Linear 328-354 - 111576 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 19463732 GenBank Protein: BAO50870.1 Fag e 1 - PQFYISTCRAGRD Sequential / Linear 376-388 - 111640 IgE from serum of buckwheat allergic patients - - Minor epitope Western / Immunoblot 19463732 GenBank Protein: BAO50870.1 Fag e 1 - HASVFKGMPIPVLSNSYQISPR Sequential / Linear 409-430 - 111393 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 19463732 GenBank Protein: BAO50870.1 Fag e 1 - QTRSHEHGLFSPFGGRS Sequential / Linear 447-453 - 111692 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 19463732 GenBank Protein: BAO50870.1 Fag e 1 - NNLPILEF Sequential / Linear 384-391 - 10192 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 15310064 - Fag e 1 - WNLNAH Sequential / Linear 411-416 - 21776 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 15310064 - Fag e 1 - EGRSVF Sequential / Linear 434-439 - 18963 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 15310064 - Fag e 1 - KAGNEG Sequential / Linear 460-465 - 5604 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 15310064 - Fag e 1 - IAGKTSVLRA Sequential / Linear 482-491 - 25291 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 15310064 - Fag e 1 - KEAFRL Sequential / Linear 506-511 - 8789 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 15310064 - Fag e 1 - SRDEKERERF Sequential / Linear 526-535 - 60632 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 15310064 - Fag e 1 - SSTMRARQCRLDQLTSSQ Sequential / Linear 23-40 - 111804 IgE from serum of buckwheat allergic patients - - Major epitope Western / Immunoblot 19463732 GenBank Protein: BAO50870.1 Fag e 2 Fag e 2.0101 EGVRDLKE Sequential / Linear 99-106 - 138364 IgE from serum of buckwheat-allergic patients - - - ELISA 20407269 - Fag t 1 - RAGRINTVNSNNLPILEFLQLSAQHVVLYKNAIIGPRWNLN Sequential / Linear 27-67 - 136587 IgE from serum of buckwheat-allergic patients - - - ELISA 20431913 - Fel d 1 Fel d 1.0101 VAQYKALPVVLENA Sequential / Linear 47-60 1PUO  1ZKR  2EJN   67729 IgE from serum of Cat allergic patients - - - Radio Immunoassay 7508463 Epitope on Chain A Fel d 1 Fel d 1.0101 DAKMTEEDKENALS Sequential / Linear 68-81 1PUO  1ZKR  2EJN   7562 IgE from serum of Cat allergic patients - - - Radio Immunoassay 7508463 Epitope on Chain A Fel d 1 Fel d 1.0101 FAVANGNELLLDLS Sequential / Linear 32-45 1PUO  1ZKR  2EJN   15295 IgE from serum of Cat allergic patients - - - Radio Immunoassay 7508463 Epitope on Chain B Fel d 1 Fel d 1.0101 EICPAVKRDVDLFLTG Sequential / Linear 23-38 1PUO  1ZKR  2EJN   12408 Monoclonal antibody - - - Radio Immunoassay 7687098 Epitope on Chain A Fel d 1 Fel d 1.0101 LDKIYTSPLC Sequential / Linear 82-92 1PUO  1ZKR  2EJN   37165 Monoclonal antibody - - - Radio Immunoassay 7687098 Epitope on Chain A Fel d 1 Fel d 1.0101 VKMAETCPIFYDVF Sequential / Linear 18-31 1ZKR  2EJN   69271 Monoclonal antibody - - - Radio Immunoassay 7687098 Epitope on Chain B Fel d 1 Fel d 1.0101 KKIQDCYVENGLI Sequential / Linear 60-72 1PUO  1ZKR  2EJN   31580 Monoclonal antibody - - - Radio Immunoassay 7687098 Epitope on Chain A Fes e 1 - STFYGKPTGAGPK Sequential / Linear 23-35 - 61612 Monoclonal antibody 24.64 - - - ELISA and Inhibition ELISA 9314345 - Gad c 1 Gad c 1.0101 VGLDAFSADELK Sequential / Linear 33-44 - - IgE from serum of individuals allergic to codfish - - - Prausnitz-Küstner(PK) and radioallergosorbent(RAST) test 6356964 - Gad c 1 Gad c 1.0101 IADEDKEGFIEEDELK Sequential / Linear 49-64 - - IgE from serum of individuals allergic to codfish - - - Prausnitz-Küstner(PK) and radioallergosorbent(RAST) test 6356964 - Gad c 1 Gad c 1.0101 LFLIAFAADL Sequential / Linear 65-74 - - IgE from serum of individuals allergic to codfish - - - Prausnitz-Küstner(PK) and radioallergosorbent(RAST) test 6356964 - Gad c 1 Gad c 1.0101 AGDSDGDGKI Sequential / Linear 88-97 - - IgE from serum of individuals allergic to codfish - - - Prausnitz-Küstner(PK) and radioallergosorbent(RAST) test 6356964 - Gad m 1 Gad m 1.0101 LKLFLQV Sequential / Linear 64-70 - - Sera from healthy and fish allergic patients - - - ELISA 30974223 - Gad m 1 Gad m 1.0201 GDGKIGVDEFGAMIKA Sequential / Linear 94-109 2MBX   189639 Sera from fish-allergic patients with specific IgE to cod parvalbumin - - Major epitope ELISA 23554100 - Gal d 1 Gal d 1.0101 TDGVTYTNDCL Sequential / Linear 56-66 - 63164 IgE from pooled serum of egg allergic patients - - Major epitope Western / Immunoblot 11944924 - Gal d 1 Gal d 1.0101 AEVDCSRFPN Sequential / Linear 25-34 - 114732 IgE from serum of children with persistent egg allergy - - Major epitope Western / Immunoblot 17573723 Epitope in persistent egg allergy Gal d 1 Gal d 1.0101 ATDKEGKDVL Sequential / Linear 35-44 - 114749 IgE from serum of children with persistent egg allergy - - Major epitope Western / Immunoblot 17573723 Epitope in persistent egg allergy Gal d 1 Gal d 1.0101 SIEFGTNISK Sequential / Linear 71-80 - 114948 IgE from serum of children with persistent egg allergy - - Major epitope Western / Immunoblot 17573723 Epitope in persistent egg allergy Gal d 1 Gal d 1.0101 VEQGASVDKR Sequential / Linear 137-146 - 114972 IgE from serum of children with persistent egg allergy - - Major epitope Western / Immunoblot 17573723 Epitope in persistent egg allergy Gal d 1 Gal d 1.0101 AEVDCSRFPNATDKEGKDVL Sequential / Linear 25-44 - 1209 IgE from serum of egg allergic patients - - - Western / Immunoblot 9257870 - Gal d 1 Gal d 1.0101 EFGTNISK Sequential / Linear 73-80 - 12004 IgE from serum of egg allergic patients - - - Western / Immunoblot 9257870 - Gal d 1 Gal d 1.0101 VLCNRAFNPVCG Sequential / Linear 109-120 - 69399 IgE from serum of egg allergic patients - - - Western / Immunoblot 9257870 - Gal d 1 Gal d 1.0101 QGASVDKR Sequential / Linear 149-146 - 50833 IgE from serum of egg allergic patients - - - Western / Immunoblot 9257870 - Gal d 1 Gal d 1.0101 NGTLTLSHFGKC Sequential / Linear 199-210 - 44083 IgE from serum of egg allergic patients - - - Western / Immunoblot 9257870 - Gal d 1 Gal d 1.0101 SRFPNATDKEGK Sequential / Linear 30-41 - 1310201 Patients sensitized to components rGal d 1, rGal d 3 - - - Microarray 32909666 - Gal d 1 Gal d 1.0101 DCLLCAYSIEF Sequential / Linear 64-74 - 7713 IgE from pooled serum of egg allergic patients - - Major epitope Western / Immunoblot 11944924 - Gal d 1 Gal d 1.0101 KEGKDVLVCNKDL Sequential / Linear 39-50 - - Patients sensitized to components rGal d 1, rGal d 3 - - - Microarray 32909666 - Gal d 1 Gal d 1.0101 GECKETVPMNCS Sequential / Linear 84-95 - 1310098 Patients sensitized to components rGal d 1, rGal d 3 - - - Microarray 32909666 - Gal d 1 Gal d 1.0101 KEHDGECKETV Sequential / Linear 80-90 - 30424 IgE from pooled serum of egg allergic patients - - Major epitope Western / Immunoblot 11944924 - Gal d 1 Gal d 1.0101 SSYAN Sequential / Linear 95-99 - 61478 IgE from pooled serum of egg allergic patients - - Major epitope Western / Immunoblot 11944924 - Gal d 1 Gal d 1.0101 DGKVMVLCNRA Sequential / Linear 104-114 - 8431 IgE from pooled serum of egg allergic patients - - Major epitope Western / Immunoblot 11944924 - Gal d 1 Gal d 1.0101 TYDNE Sequential / Linear 125-129 - 67323 IgE from pooled serum of egg allergic patients - - Major epitope Western / Immunoblot 11944924 - Gal d 1 Gal d 1.0101 KRHDGGCRKE Sequential / Linear 145-154 - 33148 IgE from pooled serum of egg allergic patients - - Major epitope Western / Immunoblot 11944924 - Gal d 1 Gal d 1.0101 KTYGNKCNFCNAVVES Sequential / Linear 183-198 - 33923 IgE from pooled serum of egg allergic patients - - Major epitope Western / Immunoblot 11944924 - Gal d 1 Gal d 1.0101 TLSHFGKC Sequential / Linear 203-210 - 65102 IgE from pooled serum of egg allergic patients - - Major epitope Western / Immunoblot 11944924 - Gal d 2 Gal d 2.0101 LAMVYLGAKDST Sequential / Linear 39-50 1JTI  1OVA  1UHG   34879 IgE from serum of patients allergic to egg white - - Immunodominant epitope Western / Immunoblot 14600204 - Gal d 2 Gal d 2.0101 ERKIKV Sequential / Linear 276-281 1JTI  1OVA  1UHG   14009 IgE from ovalbumin sensitized BALB/c mice - - - Western / Immunoblot 17236828 IgE epitope in a murine model Gal d 2 Gal d 2.0101 GITDVF Sequential / Linear 302-307 1JTI  1OVA  1UHG   20453 IgE from ovalbumin sensitized BALB/c mice - - - Western / Immunoblot 17236828 IgE epitope in a murine model Gal d 2 Gal d 2.0101 ISQAVHAAHA Sequential / Linear 324-333 1JTI  1OVA  1UHG   28669 IgE from ovalbumin sensitized BALB/c mice - - - Western / Immunoblot 17236828 IgE epitope in a murine model Gal d 2 Gal d 2.0101 AVLFFGRCVS Sequential / Linear 376-385 1JTI  1OVA  1UHG   5429 IgE from ovalbumin sensitized BALB/c mice - - - Western / Immunoblot 17236828 IgE epitope in a murine model Gal d 2 Gal d 2.0101 DVYSFSLA Sequential / Linear 96-103 1JTI  1OVA  1UHG   10794 IgE from serum of patients allergic to egg white - - Immunodominant epitope Western / Immunoblot 14600204 - Gal d 2 Gal d 2.0101 EDTQAMPFRV Sequential / Linear 192-201 1JTI  1OVA  1UHG   11453 IgE from serum of patients allergic to egg white - - Immunodominant epitope Western / Immunoblot 14600204 - Gal d 2 Gal d 2.0101 VLLPDE Sequential / Linear 244-249 1JTI  1OVA  1UHG   69619 IgE from serum of patients allergic to egg white - - Immunodominant epitope Western / Immunoblot 14600204 - Gal d 2 Gal d 2.0101 GLEQLESIIN Sequential / Linear 252-261 - 20825 IgE from serum of patients allergic to egg white - - Immunodominant epitope Western / Immunoblot 14600204 1JTI, 1OVA, 1UHG Gal d 2 Gal d 2.0101 INKVVRFD Sequential / Linear 54-61 1JTI  1OVA  1UHG   27678 IgE from ovalbumin sensitized BALB/c mice - - - Western / Immunoblot 17236828 IgE epitope in a murine model Gal d 2 Gal d 2.0101 VNVHSSLR Sequential / Linear 78-85 1JTI  1OVA  1UHG   70213 IgE from ovalbumin sensitized BALB/c mice - - - Western / Immunoblot 17236828 IgE epitope in a murine model Gal d 2 Gal d 2.0101 SRLYAE Sequential / Linear 104-109 1JTI  1OVA  1UHG   60734 IgE from ovalbumin sensitized BALB/c mice - - - Western / Immunoblot 17236828 IgE epitope in a murine model Gal d 2 Gal d 2.0101 GGLEPINFQT Sequential / Linear 128-137 1JTI  1OVA  1UHG   19906 IgE from ovalbumin sensitized BALB/c mice - - - Western / Immunoblot 17236828 IgE epitope in a murine model Gal d 4 Gal d 4.0101 SALLSSDITAS Sequential / Linear 99-109 1NDG   2218409 Chinese egg-allergic sera - - Immunodominant epitope Dot blot 37053565 - Gal d 4 Gal d 4.0101 GNGMNAWVAWR Sequential / Linear 120-130 1NDG   2218347 Chinese egg-allergic sera - - Immunodominant epitope Dot blot 37053565 - Gal d 4 Gal d 4.0101 FGRCELAAAMK Sequential / Linear 21-31 1NDG   2218334 Chinese egg-allergic sera - - - Dot blot 37053565 - Gal d 4 Gal d 4.0101 DNYRG Sequential / Linear 36-40 1NDG   2218325 Chinese egg-allergic sera - - - Dot blot 37053565 - Gal d 4 Gal d 4.0101 CAAKF Sequential / Linear 48-52 1NDG   2218316 Chinese egg-allergic sera - - - Dot blot 37053565 - Gal d 4 Gal d 4.0101 WCNDGRTPGSR Sequential / Linear 81-91 1NDG   2218437 Chinese egg-allergic sera - - - Dot blot 37053565 - Gal d 4 Gal d 4.0101 LCNIP Sequential / Linear 93-97 1NDG   2218366 Chinese egg-allergic sera - - - Dot blot 37053565 - Gal d 4 Gal d 4.0101 LSSDITAS Sequential / Linear 102-109 1NDG   2218377 Chinese egg-allergic sera - - - Dot blot 37053565 - Gal d 4 Gal d 4.0101 CKG Sequential / Linear 133-135 1NDG   2218320 Chinese egg-allergic sera - - - Dot blot 37053565 - Gal d 4 Gal d 4.0101 SLGNWVCAAKF Sequential / Linear 42-52 1NDG   2218413 Chinese egg-allergic sera - - Immunodominant epitope Dot blot 37053565 - Gal d YGP40 - AEAPSAVLENLKARCSVSYNKIKTFNEVKF Sequential / Linear 1567-1596 - - IgE from sera of YGP40-positive patients - - - Dot blot 29669337 - Gal d YGP40 - NYSMPANCYHILVQDCSSELKFLVMMK Sequential / Linear 1597-1623 - - IgE from sera of YGP40-positive patients - - - Dot blot 29669337 - Gal d YGP40 - CAKGCSATKTTPVTVGFHCLPADSANSLTDK Sequential / Linear 1790-1820 - - IgE from sera of YGP40-positive patients - - - Dot blot 29669337 - Gal d YGP40 - QMKYDQKSEDMQDTVDAHTTCSCENEECST Sequential / Linear 1821-1850 - - IgE from sera of YGP40-positive patients - - - Dot blot 29669337 - Gly m 4 Gly m 4.0101 NVEG Sequential / Linear 43-46 2K7H   - IgE from pooled serum of patients with soy allergy - - - Microarray, Phage Display 27906504 IgE-binding consensus motif Gly m 4 Gly m 4.0101 IDEA Sequential / Linear 74-77 2K7H   - IgE from pooled serum of patients with soy allergy - - - Microarray, Phage Display 27906504 IgE-binding consensus motif Gly m 4 Gly m 4.0101 NLGYSY Sequential / Linear 78-83 2K7H   - IgE from pooled serum of patients with soy allergy - - - Microarray, Phage Display 27906504 IgE-binding consensus motif Gly m 5 Gly m 5.0101 ECEEGEIPRPRPRPQHPEREPQQPGEKEE Sequential / Linear 5-33 - 181299 IgE from serum of soybean allergic patients - - Major epitope Dot-blot inhibition assay 23454299 - Gly m 5 Gly m 5.0101 DPIYSNKLGKFFEITPEKNPQLRDLD Sequential / Linear 350-375 - 181292 IgE from serum of soybean allergic patients - - Major epitope Dot-blot inhibition assay 23454299 - Gly m 5 Gly m 5.0101 QRESYFVDAQPKKKEEGNKGRKGPLSSILR Sequential / Linear 510-540 - 181434 IgE from serum of soybean allergic patients - - Major epitope Dot-blot inhibition assay 23454299 - Gly m 5 Gly m 5.0101 LRRHKNKNPFLFGSNRFE Sequential / Linear 125-142 - - Alpha casein-specific mAb 1D5 - - - Dot blot, MALDI-TOF MS 28643898 Bos d 9 cross-reactive epitope Gly m 5 Gly m 5.0101 KNPQLRDLDIFLSIVDMNE Sequential / Linear 367-385 - - Alpha casein-specific mAb 1D5 - - - Dot blot, MALDI-TOF MS 28643898 Bos d 9 cross-reactive epitope Gly m 5 Gly m 5.0101 GNKGRKGPLSSILRAFY Sequential / Linear 527-543 - - Alpha casein-specific mAb 1D5 - - - Dot blot, MALDI-TOF MS 28643898 Bos d 9 cross-reactive epitope Gly m 5 Gly m 5.0101 QLQNLRDYRILEFNSKPNT Sequential / Linear 164-182 - 1387227 Sera from infants allergic to Cow Milk or mice mAbs - - - Western / Immunoblot 32896409 Bos d 9 IgE and IgG cross-reactive epitope Gly m 5 Gly m 5.0101 KEQIRALSKRAKSSSRKTISSED Sequential / Linear 319-341 - 1383331 Sera from infants allergic to Cow Milk or mice mAbs - - - Western / Immunoblot 32896409 Bos d 9 IgE and IgG cross-reactive epitope Gly m 5 Gly m 5.0101 HEQREEQEWPRKEEKRGEKGSEEEDE Sequential / Linear 55-80 - 181334 IgE from serum of soybean allergic patients - - Major epitope Dot-blot inhibition assay 23454299 - Gly m 5 Gly m 5.0101 QFPFPRPPHQKEERKQEEDEDEEQQR Sequential / Linear 90-115 - 181432 IgE from serum of soybean allergic patients - - Major epitope Dot-blot inhibition assay 23454299 - Gly m 5 Gly m 5.0101 DEEQQRESEESEDSELRRHKNKNPFL Sequential / Linear 110-135 - 181288 IgE from serum of soybean allergic patients - - Major epitope Dot-blot inhibition assay 23454299 - Gly m 5 Gly m 5.0101 NKNPFLFGSNRFETLFKNQYGRIRVLQRF Sequential / Linear 130-158 - 181406 IgE from serum of soybean allergic patients - - Major epitope Dot-blot inhibition assay 23454299 - Gly m 5 Gly m 5.0101 TAILSLVNNDDRDSYRLQSGDALRVPSGT Sequential / Linear 200-229 - 181474 IgE from serum of soybean allergic patients - - Major epitope Dot-blot inhibition assay 23454299 - Gly m 5 Gly m 5.0101 YYVVNPDNNENLRLITLAIPVNKPGRFES Sequential / Linear 230-260 - 181524 IgE from serum of soybean allergic patients - - Major epitope Dot-blot inhibition assay 23454299 - Gly m 5 Gly m 5.0101 EQIRALSKRAKSSSRKTISSEDKPFN Sequential / Linear 320-345 - 181307 IgE from serum of soybean allergic patients - - Major epitope Dot-blot inhibition assay 23454299 - Gly m 5 Gly m 5.0101 SEDKPFNLRSRDPIYSNKLGKFFEITPEKN Sequential / Linear 338-368 - 181455 IgE from serum of soybean allergic patients - - Major epitope Dot-blot inhibition assay 23454299 - Gly m 5 Gly m 5.0301 GRIRLLQRFNKRSPQLENLRDYR Sequential / Linear 51-73 1UIJ  1IPJ  1IPK   - Sera from soybean allergic patients - - - ELISA 32198043 Also an IgG-binding epitope Gly m 5 Gly m 5.0301 LSRRAKSSSRKTISSEDEPFNLRSRNPIYS Sequential / Linear 221-250 1UIJ  1IPJ  1IPK   - Sera from soybean allergic patients - - - ELISA 32198043 Also an IgG-binding epitope Gly m 6 Gly m 6.0101 GGSILSGFTLEFLEHAFSV Sequential / Linear 217-235 1FXZ  1UCX  1UD1   ( ! ) Deprecated: Function split() is deprecated in C:\wamp\www\AllerBase\PHP_codes\BrSeqEpi.php on line 606 Call Stack # Time Memory Function Location 1 0.0432 791368 {main}( ) ..\BrSeqEpi.php:0 20021 19632 IgE from pooled serum of soy-allergic patient - - - Western / Immunoblot 11146387 Ara h 3 homologous epitope Gly m 6 Gly m 6.0101 GAIVTVKGGLSVI Sequential / Linear 253-265 1FXZ  1UCX  1UD1   18633 IgE from pooled serum of soy-allergic patient - - - Western / Immunoblot 11146387 Ara h 3 homologous epitope Gly m 6 Gly m 6.0201 SGFAPEFLKEAFGVN Sequential / Linear 219-233 - 58026 IgE from pooled serum of soybean and peanut-allergic patient - - Immunodominant epitope Western / Immunoblot and structural model 12485602 - Gly m 6 Gly m 6.0201 MFVPHYTLNANSIIY Sequential / Linear 358-372 - 41548 IgE from serum of soybean allergic patients - - - Western / Immunoblot and structural model 11112857 - Gly m 6 Gly m 6.0201 NANSIIYALNGRALV Sequential / Linear 367-381 - 43262 IgE from serum of soybean allergic patients - - - Western / Immunoblot and structural model 11112857 - Gly m 6 Gly m 6.0201 QHTFNLKSQQARQVK Sequential / Linear 469-475 - 51031 IgE from serum of soybean allergic patients - - Immunodominant epitope Western / Immunoblot and structural model 11112857 - Gly m 6 Gly m 6.0201 AIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVE Sequential / Linear 251-286 - - IgE from serum of allergic patients - - Immunodominant epitope ELISA 36335553 - Gly m 6 Gly m 6.0201 KLVLSLCFLLFSGCF Sequential / Linear 3-17 - 32233 IgE from serum of soybean allergic patients - - - Western / Immunoblot and structural model 11112857 - Gly m 6 Gly m 6.0201 NGPQEIYIQQGNGIF Sequential / Linear 83-97 - 44051 IgE from serum of soybean allergic patients - - Immunodominant epitope Western / Immunoblot and structural model 11112857 - Gly m 6 Gly m 6.0201 QQGNGIFGMIFPGCP Sequential / Linear 90-104 - 52031 IgE from serum of soybean allergic patients - - - Western / Immunoblot and structural model 11112857 - Gly m 6 Gly m 6.0201 RFYLAGNQEQEFLKY Sequential / Linear 177-191 - 53810 IgE from serum of soybean allergic patients - - Immunodominant epitope Western / Immunoblot and structural model 11112857 - Gly m 6 Gly m 6.0201 LKYQQQQQGGSQSQK Sequential / Linear 189-203 - 37068 IgE from serum of soybean allergic patients - - - Western / Immunoblot and structural model 11112857 - Gly m 6 Gly m 6.0201 VKGGLRVTAPAMRKP Sequential / Linear 255-269 - 69226 IgE from serum of soybean allergic patients - - - Western / Immunoblot and structural model 11112857 - Gly m 6 Gly m 6.0201 LDFPALWLLKLSAQY Sequential / Linear 337-351 - 35160 IgE from serum of soybean allergic patients - - - Western / Immunoblot and structural model 11112857 - Gly m 6 Gly m 6.0201 LKLSAQYGSLRKNAM Sequential / Linear 345-359 - 36948 IgE from serum of soybean allergic patients - - Immunodominant epitope Western / Immunoblot and structural model 11112857 - Gly m 8 Gly m 8.0101 NLNPCEHIMEKI Sequential / Linear 39-50 - 561714 Serum from patients with peanut and soybean allergies - - - Microarray 27187334 GenBank Protein: AAD09630 Gly m 8 Gly m 8.0101 TMPGRINYIRKK Sequential / Linear 69-80 - 561782 Serum from patients with peanut and soybean allergies - - - Microarray 27187334 GenBank Protein: AAD09630 Gly m 8 Gly m 8.0101 EEEEEGHMQKC Sequential / Linear 84-94 - 561645 Serum from patients with peanut and soybean allergies - - - Microarray 27187334 GenBank Protein: AAD09630 Gly m 8 Gly m 8.0101 SELKSPICQCKA Sequential / Linear 99-110 - 561747 Serum from patients with peanut and soybean allergies - - - Microarray 27187334 GenBank Protein: AAD09630 Gly m 8 Gly m 8.0101 CRKQLQGVNLTP Sequential / Linear 31-42 - 561628 Serum from patients with peanut and soybean allergies - - - Microarray 27187334 GenBank Protein: AAD00178 Gly m 8 Gly m 8.0101 ILRTMRGRINYI Sequential / Linear 67-78 - 561682 Serum from patients with peanut and soybean allergies - - - Microarray 27187334 GenBank Protein: AAD00178 Gly m 8 Gly m 8.0101 SELRSPKCQCKA Sequential / Linear 102-113 - 561749 Serum from patients with peanut and soybean allergies - - - Microarray 27187334 GenBank Protein: AAD00178 Gly m 8 Gly m 8.0101 EKQKKKMEKELI Sequential / Linear 127-138 - 561656 Serum from patients with peanut and soybean allergies - - - Microarray 27187334 GenBank Protein: AAD00178 Gly m Bd30K - FLVLLLFSLL Sequential / Linear 3-12 - 16955 IgE from pooled serum from soybean-sensitive patients - - Immunodominant epitope Western / Immunoblot 9751845 - Gly m Bd30K - PQEFSKKYLQ Sequential / Linear 100-109 - 48988 IgE from pooled serum from soybean-sensitive patients - - Immunodominant epitope Western / Immunoblot 9751845 - Gly m Bd30K - RCKANKIQDK Sequential / Linear 229-238 - 53282 IgE from pooled serum from soybean-sensitive patients - - Immunodominant epitope Western / Immunoblot 9751845 - Gly m Bd30K - INHFVLLVGY Sequential / Linear 299-308 - 27650 IgE from pooled serum from soybean-sensitive patients - - Immunodominant epitope Western / Immunoblot 9751845 - Gly m Bd30K - GYIWIQRNTG Sequential / Linear 331-340 - 23372 IgE from pooled serum from soybean-sensitive patients - - Immunodominant epitope Western / Immunoblot 9751845 - Hali di Trp - AMKMEKENAVDRAEQ Sequential / Linear 10-24 - - IgE from sera of abalone-sensitive patients - - - Dot blot, ELISA 34881872 - Hali di Trp - NEQKLRDTEEQKAKIEE Sequential / Linear 25-41 - - IgE from sera of abalone-sensitive patients - - - Dot blot, ELISA 34881872 - Hali di Trp - QEAMAKLETSEKRVT Sequential / Linear 65-79 - - IgE from sera of abalone-sensitive patients - - - Dot blot, ELISA 34881872 - Hali di Trp - AQLKEAKYIAED Sequential / Linear 146-157 - - IgE from sera of abalone-sensitive patients - - - Dot blot, ELISA 34881872 - Hali di Trp - EAARKLAITEVDLER Sequential / Linear 164-178 - - IgE from sera of abalone-sensitive patients - - - Dot blot, ELISA 34881872 - Hali di Trp - EAAEAKILELEEEL Sequential / Linear 184-197 - - IgE from sera of abalone-sensitive patients - - - Dot blot, ELISA 34881872 - Hali di Trp - VVGNNMKSLEISEQ Sequential / Linear 199-212 - - IgE from sera of abalone-sensitive patients - - - Dot blot, ELISA 34881872 - Hev b 1 Hev b 1.0101 FSNVYLFAKDKSGPLQPGV Sequential / Linear 32-50 - 17795 IgE from serum of latex allergic patients - - - ELISA 8732237 - Hev b 1 Hev b 1.0101 IDRSLPPIVK Sequential / Linear 90-99 - 25664 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 1 Hev b 1.0101 KDASIQVVSA Sequential / Linear 99-108 - 30115 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 1 Hev b 1.0101 QPGVDIIEGPVKNVAVPLY Sequential / Linear 47-65 - 51847 IgE from serum of latex allergic patients - - - ELISA and Antigen Competition 8732237 - Hev b 1 Hev b 1.0101 SLPGQTKILAKVFYGEN Sequential / Linear 122-138 - 59387 IgE from serum of latex allergic patients - - - ELISA and Antigen Competition 8732237 - Hev b 1 Hev b 1.0101 AEDEDNQQGQ Sequential / Linear 2-11 - 849 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 1 Hev b 1.0101 KYLGFVQDAA Sequential / Linear 16-25 - 34502 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot and Antigen Competition 11275264 - Hev b 1 Hev b 1.0101 YLFAKDKSGP Sequential / Linear 36-45 - 74645 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 1 Hev b 1.0101 LQPGVDIIEG Sequential / Linear 46-55 - 38948 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot and Antigen Competition 11275264 - Hev b 1 Hev b 1.0101 AVPLYNRFSY Sequential / Linear 61-70 - 5502 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 1 Hev b 1.0101 YNRFSYIPNG Sequential / Linear 65-74 - 75209 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 13 Hev b 13.0101 AESFNLPYLSPYLSSLGSNFKH Sequential / Linear 82-103 - - IgE from serum of latex-allergic patients - - - Western / Immunoblot 19945164 - Hev b 13 Hev b 13.0101 YSQFRQFIPRSQFIR Sequential / Linear 136-150 - - IgE from serum of latex-allergic patients - - - Western / Immunoblot 19945164 - Hev b 13 Hev b 13.0101 LVNSFSANVKKIYDLGARTFWI Sequential / Linear 199-220 - - IgE from serum of latex-allergic patients - - - Western / Immunoblot 19945164 - Hev b 13 Hev b 13.0101 LTYFPWAEKDSA Sequential / Linear 233-244 - - IgE from serum of latex-allergic patients - - - Western / Immunoblot 19945164 - Hev b 13 Hev b 13.0101 QHFNH Sequential / Linear 255-259 - - IgE from serum of latex-allergic patients - - - Western / Immunoblot 19945164 - Hev b 13 Hev b 13.0101 VAQLRKDLPLATFV Sequential / Linear 265-278 - - IgE from serum of latex-allergic patients - - - Western / Immunoblot 19945164 - Hev b 13 Hev b 13.0101 VKYSLFSE Sequential / Linear 285-292 - - IgE from serum of latex-allergic patients - - - Western / Immunoblot 19945164 - Hev b 13 Hev b 13.0101 FPLITCCG Sequential / Linear 300-307 - - IgE from serum of latex-allergic patients - - - Western / Immunoblot 19945164 - Hev b 2 Hev b 2.0101 VSEVIALYKKSNITRMRIYDPNRA Sequential / Linear 52-75 4HPG  4IIS   111923 IgE from serum of latex allergic patients - - - Western / Immunoblot 19185347 - Hev b 2 Hev b 2.0101 TNPSNAKSWVQKNVRGFWSSVLFR Sequential / Linear 100-123 - 111839 IgE from serum of latex allergic patients - - - Western / Immunoblot 19185347 - Hev b 2 Hev b 2.0101 AWLAQFVLP Sequential / Linear 139-147 4HPG  4IIS   111135 IgE from serum of latex allergic patients - - - Western / Immunoblot 19185347 - Hev b 2 Hev b 2.0101 DQIKVSTAIDLT Sequential / Linear 163-174 4HPG  4IIS   111212 IgE from serum of latex allergic patients - - - Western / Immunoblot 19185347 - Hev b 2 Hev b 2.0101 DPIIGFLSSIRSPLL Sequential / Linear 196-210 4HPG  4IIS   111209 IgE from serum of latex allergic patients - - - Western / Immunoblot 19185347 - Hev b 2 Hev b 2.0101 WDGQRGYKNLFDATLDAL Sequential / Linear 241-258 4HPG  4IIS   111945 IgE from serum of latex allergic patients - - - Western / Immunoblot 19185347 - Hev b 2 Hev b 2.0101 NLIQHVKGGTPKRPN Sequential / Linear 298-312 - 111588 IgE from serum of latex allergic patients - - - Western / Immunoblot 19185347 - Hev b 2 Hev b 2.0101 GLFFPDKRPKYNLNF Sequential / Linear 337-351 - 111347 IgE from serum of latex allergic patients - - - Western / Immunoblot 19185347 - Hev b 2 Hev b 2.0101 TEHNATILFLKSDM Sequential / Linear 361-374 - 111822 IgE from serum of latex allergic patients - - - Western / Immunoblot 19185347 - Hev b 3 Hev b 3.0101 AEEVEEERLK Sequential / Linear 2-11 - 893 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 3 Hev b 3.0101 VPTAVYFSEK Sequential / Linear 159-168 - 70490 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 3 Hev b 3.0101 QGYRVSSYLP Sequential / Linear 179-188 - 50990 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 3 Hev b 3.0101 ERLKYLDFVR Sequential / Linear 8-17 - 14028 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 3 Hev b 3.0101 TLYLYAKDIS Sequential / Linear 29-38 - 65160 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 3 Hev b 3.0101 LKPGVDTIEN Sequential / Linear 41-50 - 36988 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 3 Hev b 3.0101 YYIPLEAVKFV Sequential / Linear 60-70 - 76523 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot and Antigen Competition 11275264 - Hev b 3 Hev b 3.0101 VPPVIKQVSA Sequential / Linear 85-94 - 70439 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 3 Hev b 3.0101 APRIVLDVAS Sequential / Linear 103-112 - 3780 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 3 Hev b 3.0101 GVQEGAKALY Sequential / Linear 118-127 - 23107 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 3 Hev b 3.0101 AVITWRALNK Sequential / Linear 138-147 - 5391 IgE from serum of latex allergic patients with spina bifida - - Immunodominant epitope Western / Immunoblot 11275264 - Hev b 5 Hev b 5.0101 KNETPEVT Sequential / Linear 15-22 - 98174 IgE from serum of latex allergic subjects - - - Western / Immunoblot 10359901 - Hev b 5 Hev b 5.0101 PITEAAET Sequential / Linear 132-139 - 78242 IgE from serum of latex allergic subjects - - - Western / Immunoblot 10359901 - Hev b 5 Hev b 5.0101 TEVPVEKT Sequential / Linear 142-149 - 78276 IgE from serum of latex allergic subjects - - - Western / Immunoblot 11398087 - Hev b 5 Hev b 5.0101 TKTEEPAA Sequential / Linear 27-34 - 78137 IgE from serum of latex allergic subjects - - - Western / Immunoblot 11398087 - Hev b 5 Hev b 5.0101 APPASEQET Sequential / Linear 34-42 - 78104 IgE from serum of latex allergic subjects - - - Western / Immunoblot 11398087 - Hev b 5 Hev b 5.0101 EEPTAAPAEP Sequential / Linear 50-59 - 78142 IgE from serum of latex allergic subjects - - - Western / Immunoblot 11398087 - Hev b 5 Hev b 5.0101 EKAEEVEK Sequential / Linear 67-74 - 78141 IgE from serum of latex allergic subjects - - - Western / Immunoblot 11398087 - Hev b 5 Hev b 5.0101 IEKTEEPA Sequential / Linear 75-82 - 78143 IgE from serum of latex allergic subjects - - - Western / Immunoblot 11398087 - Hev b 5 Hev b 5.0101 DQTTPEEKPAEPE Sequential / Linear 86-98 - 78255 IgE from serum of latex allergic subjects - - - Western / Immunoblot 11398087 - Hev b 5 Hev b 5.0101 EEPKHETK Sequential / Linear 103-111 - 78136 IgE from serum of latex allergic subjects - - - Western / Immunoblot 11398087 - Hev b 5 Hev b 5.0101 EKPAEEEKP Sequential / Linear 124-132 - 78145 IgE from serum of latex allergic subjects - - - Western / Immunoblot 11398087 - Hev b 6 Hev b 6.01 PNNLCCSQWGWC Sequential / Linear 30-41 1Q9B  1T0W  4WP4  1WKX  1HEV   95674 IgE from serum of latex allergic subjects - - - Western / Immunoblot 9097919 - Hev b 6 Hev b 6.01 EYCSPDHN Sequential / Linear 46-53 1Q9B  4WP4  1WKX  1HEV   95371 IgE from serum of latex allergic subjects - - - Western / Immunoblot 9097919 - Hev b 6 Hev b 6.01 LYNSQDHG Sequential / Linear 79-85 - 95583 IgE from serum of latex allergic subjects - - - Western / Immunoblot 9097919 - Hev b 6 Hev b 6.01 AASAYCST Sequential / Linear 91-98 - 95201 IgE from serum of latex allergic subjects - - - Western / Immunoblot 9097919 - Hev b 6 Hev b 6.01 CSNGGL Sequential / Linear 151-156 - 95294 IgE from serum of latex allergic subjects - - - Western / Immunoblot 9097919 - Hev b 6 Hev b 6.01 NYQFVDCG Sequential / Linear 181-188 - 95644 IgE from serum of latex allergic subjects - - - Western / Immunoblot 9097919 - Hol l 1 Hol l 1.0101 IAKVPPGPNITATYGDEWLDAKSTWYG Sequential / Linear 26-52 - 25330 IgE from serum of velvet grass pollen-allergic patients - - - Western / Immunoblot 9215246 - Hol l 1 Hol l 1.0101 PIFKDGRGCGSCFEIK Sequential / Linear 86-101 - 47895 IgE from serum of velvet grass pollen-allergic patients - - - Western / Immunoblot 9215246 - Hol l 1 Hol l 1.0101 SGEPVTVHITDDNEEPIAPYHF Sequential / Linear 109-130 - 58020 IgE from serum of velvet grass pollen-allergic patients - - - Western / Immunoblot 9215246 - Jug r 1 Jug r 1.0101 QGLRGEEMEEMV Sequential / Linear 104-115 - 50901 IgE from serum of walnut allergic patients - - - Western / Immunoblot and Antigen Competition 11799381 - Jug r 1 Jug r 1.0101 FRTTITTMEIDEDID Sequential / Linear 16-30 - - IgE from serum of Chinese walnut allergic patients - - - Western / Immunoblot 32283362 - Jug r 1 Jug r 1.0101 CGISSQRCEIRRSWF Sequential / Linear 125-139 - - IgE from serum of Chinese walnut allergic patients - - - Western / Immunoblot 32283362 - Jug r 2 Jug r 2.0101 DQRSQEERER Sequential / Linear 49-58 - 157171 IgE from Walnut-allergic patients - - - Western / Immunoblot 21883278 - Jug r 2 Jug r 2.0101 YEQCQQQCER Sequential / Linear 76-85 7LVG   158509 IgE from Walnut-allergic patients - - - Western / Immunoblot 21883278 - Jug r 2 Jug r 2.0101 QRQCQQRCER Sequential / Linear 140-149 7LVE   157811 IgE from Walnut-allergic patients - - - Western / Immunoblot 21883278 - Jug r 2 Jug r 2.0101 QNNIINQLER Sequential / Linear 532-541 - 157802 IgE from Walnut-allergic patients - - - Western / Immunoblot 21883278 - Jug r 3 Jug r 3.0101 AVITCGQVASSVGSC Sequential / Linear 26-40 - - Sera of peanut allergic patients from USA - - - Microarray,Fluorescence immunoassay 36698378 - Jug r 3 Jug r 3.0101 SVGSCIGYLRGTVPT Sequential / Linear 36-50 - - Sera of peanut allergic patients from USA - - - Microarray,Fluorescence immunoassay 36698378 - Jug r 3 Jug r 3.0101 IGYLRGTVPTVPPSC Sequential / Linear 41-55 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Jug r 3 Jug r 3.0101 VPPSCCNGVKSLNKA Sequential / Linear 51-65 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Jug r 3 Jug r 3.0101 CNGVKSLNKAAATTA Sequential / Linear 56-70 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Jug r 3 Jug r 3.0101 AATTADRQAACECLK Sequential / Linear 66-80 - - Sera of peanut allergic patients from Spain - - - Microarray,Fluorescence immunoassay 36698378 - Jug r 3 Jug r 3.0101 GLPGKCGVSVPYKIS Sequential / Linear 96-110 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Jug r 3 Jug r 3.0101 CGVSVPYKISTSTNC Sequential / Linear 101-115 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Jug r 3 Jug r 3.0101 PYKISTSTNCKAVK Sequential / Linear 106-119 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Jug r 4 Jug r 4.0101 MAKPILLSIYLFLIV Sequential / Linear 1-15 - 114468 IgE from pooled serum of walnut and hazelnut allergic patients - - Moderately reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 LATAFQIPREDARRL Sequential / Linear 465-479 - 114442 IgE from pooled serum of walnut and hazelnut allergic patients - - Moderately reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 IESWDPNNQQFQCAG Sequential / Linear 57-71 - 114404 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 YSNAPQLVYIARGRG Sequential / Linear 89-103 - 114695 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 RQSQQGQSREFQQDR Sequential / Linear 121-135 - 114590 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 REFQQDRHQKIRHFR Sequential / Linear 129-143 - 114569 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 GDIIAFPAGVAHWSY Sequential / Linear 145-159 - 114351 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 QGQQEYEQHRRQQQR Sequential / Linear 201-215 - 114531 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 HRRQQQRQQRPGEHG Sequential / Linear 209-223 - 114396 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 QLQVIRPRWSREEQE Sequential / Linear 273-287 - 114543 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 PHWNLNAHSVVYALR Sequential / Linear 377-391 - 114508 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 TGVLFPGCPETFEES Sequential / Linear 105-119 - 114627 IgE from pooled serum of walnut and hazelnut allergic patients - - Moderately reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 SVVYALRGRAEVQVV Sequential / Linear 385-399 - 114620 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 FNRQESTLVRSRPSR Sequential / Linear 481-495 - 114339 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 VRSRPSRSRSSRSER Sequential / Linear 489-503 - 114666 IgE from pooled serum of walnut and hazelnut allergic patients - - Weakly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 VFSGFDADFLADAFN Sequential / Linear 233-247 - 114650 IgE from pooled serum of walnut and hazelnut allergic patients - - Strongly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 QSENDHRRSIVRVEG Sequential / Linear 257-271 - 114555 IgE from pooled serum of walnut and hazelnut allergic patients - - Strongly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 SIVRVEGRQLQVIRP Sequential / Linear 265-279 - 114610 IgE from pooled serum of walnut and hazelnut allergic patients - - Moderately reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 WSREEQEREERKERE Sequential / Linear 281-295 - 114676 IgE from pooled serum of walnut and hazelnut allergic patients - - Strongly reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 DDNGLEETICTLRLR Sequential / Linear 313-327 - 114293 IgE from pooled serum of walnut and hazelnut allergic patients - - Moderately reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 LTIPQNFAVVKRARN Sequential / Linear 417-431 - 114462 IgE from pooled serum of walnut and hazelnut allergic patients - - Moderately reacting epitope Western / Immunoblot 19631385 - Jug r 4 Jug r 4.0101 VVKRARNEGFEWVSF Sequential / Linear 425-439 - 114671 IgE from pooled serum of walnut and hazelnut allergic patients - - Moderately reacting epitope Western / Immunoblot 19631385 - Jun a 1 Jun a 1.0101 IFSQNMNIKLKMP Sequential / Linear 92-104 1PXZ   26167 IgE from serum of cedar pollen allergic patients - - Major epitope Western / Immunoblot 14563374 - Jun a 1 Jun a 1.0101 AFNQFGPNAGQR Sequential / Linear 239-250 1PXZ   66935 IgE from serum of cedar pollen allergic patients - - Major epitope Western / Immunoblot 14563374 - Jun a 1 Jun a 1.0101 MPRARYGL Sequential / Linear 251-258 1PXZ   42310 IgE from serum of cedar pollen allergic patients - - Major epitope Western / Immunoblot 14563374 - Jun a 1 Jun a 1.0101 WRSTRDAFING Sequential / Linear 317-327 1PXZ   73051 IgE from serum of cedar pollen allergic patients - - Minor epitope Western / Immunoblot 14563374 - Jun a 3 Jun a 3.0101 ADINAVCPSELK Sequential / Linear 146-157 7P20   687 IgE from serum of cedar hypersensitive patients - - - Western / Immunoblot 10969020 - Jun a 3 Jun a 3.0101 VDGGCNSACNVFK Sequential / Linear 158-170 7P20   67957 IgE from serum of cedar hypersensitive patients - - - Western / Immunoblot 10969020 - Jun a 3 Jun a 3.0101 NAYVDNCPATNYSK Sequential / Linear 178-191 - 43356 IgE from serum of cedar hypersensitive patients - - - Western / Immunoblot 10969020 - Lat c 1 Lat c 1.0101 MAFAGILNEADITAALAACQAADSF Sequential / Linear 1-25 - - IgE from serum of fish allergic patients - - - ELISA 33423763 - Lat c 1 Lat c 1.0101 AACQAADSFKHKDFFVKVGLAGKSD Sequential / Linear 17-41 - - IgE from serum of fish allergic patients - - - ELISA 33423763 - Lat c 1 Lat c 1.0101 EFLKAGDSDGDGKIGVDEFAALVKV Sequential / Linear 85-109 - - IgE from serum of fish allergic patients - - - ELISA 33423763 - Len c 1 Len c 1.0101 EEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAIN Sequential / Linear 313-348 - 141631 IgE from serum of Lentil allergic patients - - - Fluorescence immuno assay 20816193 - Len c 1 Len c 1.0101 PAGHPVAINASSDLNLIGFGINAKNNQ Sequential / Linear 340-366 7U1H   141721 IgE from serum of Lentil allergic patients - - - Fluorescence immuno assay 20816193 - Len c 1 Len c 1.0101 LIGFGINAKNNQRNFLAGEEDNVIS Sequential / Linear 355-379 7U1H   141700 IgE from serum of Lentil allergic patients - - - Fluorescence immuno assay 20816193 - Len c 1 Len c 1.0101 EEDNVISQIQRPVKELAFPGSSREVDR Sequential / Linear 373-399 7U1H   141628 IgE from serum of Lentil allergic patients - - - Fluorescence immuno assay 20816193 - Len c LcA - TETTSFSITKFSPDQ Sequential / Linear 31-45 1LEM  1LEN  1LES  2LAL   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Len c LcA - GDGYTTKGKLTLTKAVKSTVGRAL Sequential / Linear 52-75 1LEM  1LEN  1LES  2LAL   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Len c LcA - PIH Sequential / Linear 79-81 1LEM  1LEN  1LES  2LAL   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Len c LcA - VADEFTFFI Sequential / Linear 109-117 - - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Len c LcA - YLGVFNSKEYDK Sequential / Linear 130-141 1LEM  1LEN  1LES  2LAL   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Len c LcA - PSN Sequential / Linear 160-162 1LEM  1LEN  1LES  2LAL   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Len c LcA - HIGIDVNSIKSVNTKSWNLQNGERANV Sequential / Linear 166-192 1LEM  1LEN  1LES  2LAL   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Len c LcA - LKDVVPEWVRIG Sequential / Linear 229-240 - - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Len c LcA - AAHEVHSWSFHSELGGTSSS Sequential / Linear 250-269 - - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Lit v 1 Lit v 1.0101 MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRA Sequential / Linear 1-36 - 41215 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 1 Lit v 1.0101 QKRMQQLENDLDQVQ Sequential / Linear 47-61 - 1087239 IgE from serum of Shrimp allergic patients - - - Dot blot, ELISA, Mediator release 32334299 - Lit v 1 Lit v 1.0101 EDLERSEERLNT Sequential / Linear 97-108 - 1087203 IgE from serum of Shrimp allergic patients - - - Dot blot, ELISA, Mediator release 32334299 - Lit v 1 Lit v 1.0101 RSVQKLQKEVDRLE Sequential / Linear 244-257 - 1087243 IgE from serum of Shrimp allergic patients - - - Dot blot, ELISA, Mediator release 32334299 - Lit v 1 Lit v 1.0101 EKSEEEVHNLQKRMQQLENDLDQVQES Sequential / Linear 37-63 - 12871 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 1 Lit v 1.0101 QESLLKANIQLVEKDKALSNA Sequential / Linear 61-81 - 50696 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 1 Lit v 1.0101 EGEVAALNRRIQLLEEDLERSEER Sequential / Linear 82-105 - 116700 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 1 Lit v 1.0101 ASQAADESERMRKVLENRSLSDEERMDALENQLKE Sequential / Linear 115-150 - 11190 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 1 Lit v 1.0101 ALENQLKEARFLAEEADRKY Sequential / Linear 142-162 - 116689 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 1 Lit v 1.0101 EADRKYDEVARKLAMVEADLERAEERA Sequential / Linear 157-183 - 11011 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 1 Lit v 1.0101 IVELEEELRVVGNNLKSLEVS Sequential / Linear 190-210 - 116755 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 1 Lit v 1.0101 VQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY Sequential / Linear 246-284 - 116824 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 13 Lit v 13.0101 VEITKDGDTYTMKTTTTFKTTEIKFKLGEEFEETTADGRVVKSTIT Sequential / Linear 40-85 - 1642076 Sera from shrimp-allergic patients - - - ELISA 34695231 - Lit v 13 Lit v 13.0101 ELLREFTDDKMLMECKVDDVVCKRVYSRLE Sequential / Linear 107-136 - - Sera from shrimp-allergic patients - - - ELISA 34695231 - Lit v 13 Lit v 13.0101 TTTTFKTTEIKFKLGEEFEE Sequential / Linear 53-72 - - Sera from shrimp allergic patients sensitized to FABP - - - ELISA DOI:10.22541/au.161857969.92060255/v1 Epitope mediating cross-reactivity with Blo t 13 Lit v 2 Lit v 2.0101 MADAAVIEKLEAGFKKLE Sequential / Linear 1-18 4BG4  4BHL   179235 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 2 Lit v 2.0101 SLLKKYLTKEVFDKLKDK Sequential / Linear 25-42 4AM1  4BG4  4BHL   179503 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 2 Lit v 2.0101 GVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQT Sequential / Linear 64-96 4AM1  4BG4  4BHL   178951 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 2 Lit v 2.0101 ISTRVRCGRSLQGYPFNPCLT Sequential / Linear 121-141 4BG4  4BHL   179042 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 2 Lit v 2.0101 ESQYKEMEAKVSSTLSSL Sequential / Linear 142-159 4AM1  4BG4  4BHL   178775 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 2 Lit v 2.0101 EGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGD Sequential / Linear 160-192 4AM1  4BG4  4BHL   178730 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 2 Lit v 2.0101 SMQMGGDLGQVFRRLTSAVNEIEK Sequential / Linear 232-255 4AM1  4BG4  4BHL   179513 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 2 Lit v 2.0101 EGGIYDISNKRRMGLTEFQAVKEM Sequential / Linear 319-342 4BG4   178732 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 3 Lit v 3.0101 RSKKSGGGSNVFDMFTQR Sequential / Linear 13-30 - 179456 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 3 Lit v 3.0101 VFDMFTQRQVAEFKEGFQLMDRDKDG Sequential / Linear 22-48 - 179323 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 3 Lit v 3.0101 VIGKTDLRGTFDEIGRIA Sequential / Linear 49-66 - 179629 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 3 Lit v 3.0101 TFDEIGRIATDQELDEMLADAPAPINFTMLLNM Sequential / Linear 58-90 - 179562 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 3 Lit v 3.0101 PAPINFTMLLNMFAERQTGES Sequential / Linear 79-99 - - IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 3 Lit v 3.0101 NIDCDTFRHALMTWGDKFSSQEAD Sequential / Linear 118-141 - 179301 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 4 Lit v 4.0101 KYVVRYMYDIDNNGFLDKNDFECLAVR Sequential / Linear 10-36 - 179110 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 4 Lit v 4.0101 DAYANNQKIMRNLWNEIAELADFN Sequential / Linear 49-72 - 178640 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lit v 4 Lit v 4.0101 CITRSAFAEVKEIDDAYN Sequential / Linear 130-147 - 179453 IgE from serum of Shrimp allergic patients - - - Microarray 20471069 - Lol p 5 Lol p 5.0102 AANAPPADKFKI Sequential / Linear 74-85 - 315 IgE from serum of spring hay fever patient - - Strongly binding epitope Dot–blot Immunoassay 9747889 - Lol p 5 Lol p 5.0102 GAATAAAGGYKA Sequential / Linear - 18529 IgE from serum of spring hay fever patient - - Strongly binding epitope Dot–blot Immunoassay 9747889 - Mal d 3 Mal d 3.0101 YVRSGGAVP Sequential / Linear 40-48 - 23494 IgE from pooled serum of patients allergic to Rosaceae fruits - - - Western / Immunoblot 18036340 - Mal d 3 Mal d 3.0101 INGLARTTADRQTACNCL Sequential / Linear 58-75 - 64391 IgE from pooled serum of patients allergic to Rosaceae fruits - - - Western / Immunoblot 18036340 - Mal d 3 Mal d 3.0101 NNA Sequential / Linear 88-90 - - IgE from pooled serum of patients allergic to Rosaceae fruits - - - Western / Immunoblot 18036340 - Mal d 3 Mal d 3.0101 NVPYKISTS Sequential / Linear 100-108 - 70216 IgE from pooled serum of patients allergic to Rosaceae fruits - - - Western / Immunoblot 18036340 - Met e 1 Met e 1.0101 EEVHNLQKRMQQLENDLDQV Sequential / Linear 31-50 - - IgE from sera of patients with shrimp allergy - - - ELISA, Dot-blot 25365343 - Met e 1 Met e 1.0101 NQLKEARFLAEEADRKYDEV Sequential / Linear 136-155 - - IgE from sera of patients with shrimp allergy - - - ELISA, Dot-blot 25365343 - Met e 1 Met e 1.0101 EARAEFAERSVQKLQKEVDR Sequential / Linear 226-245 - - IgE from sera of patients with shrimp allergy - - - ELISA, Dot-blot 25365343 - Mus a 5 Mus a 5.0102 SEVVSLYKSNNIARMRLYDPNQAA Sequential / Linear 44-67 2CYG   111768 IgE from serum of latex allergic patients - - - Western / Immunoblot 19185347 Cross-reactive epitope of Hev b 2.0101 Mus a 5 Mus a 5.0102 SAAGDWIRRNVVAYW Sequential / Linear 95-109 2CYG   111752 IgE from serum of latex allergic patients - - - Western / Immunoblot 19185347 Cross-reactive epitope of Hev b 2.0101 Mus a 5 Mus a 5.0102 MRNIYNALSSAG Sequential / Linear 137-148 2CYG   111568 IgE from serum of latex allergic patients - - - Western / Immunoblot 19185347 Cross-reactive epitope of Hev b 2.0101 Mus a 5 Mus a 5.0102 NLIRHVGGGTPR Sequential / Linear 287-298 2CYG   111589 IgE from serum of latex allergic patients - - - Western / Immunoblot 19185347 Cross-reactive epitope of Hev b 2.0101 Mus a 5 Mus a 5.0102 GLFYPNKQP Sequential / Linear 326-334 2CYG   111348 IgE from serum of latex allergic patients - - - Western / Immunoblot 19185347 Cross-reactive epitope of Hev b 2.0101 Myr p 1 Myr p 1.0101 KEAIPMAVEMAKSQ Sequential / Linear 93-106 - 30292 IgE from serum of ant venom-allergic patients - - - Antigen Competition 7508264 - Nic t Osmotin Nic t Osmotin APRGTKMARVWGRT Sequential / Linear 57-70 1PCV   - IgE from serum of patients with allergic rhinitis and asthma - - - ELISA 23349964 - Nic t Osmotin Nic t Osmotin CNFNAAGRGTCQTG Sequential / Linear 72-85 1PCV   - IgE from serum of patients with allergic rhinitis and asthma - - - ELISA 23349964 - Nic t Osmotin Nic t Osmotin TANINGECPRELRVPGGCN Sequential / Linear 147-165 1PCV   - IgE from serum of patients with allergic rhinitis and asthma - - - ELISA 23349964 - Oct v 1 - RVGECESEIAGLNRRIQLLEEDLERSEERLSTAQTK Sequential / Linear 77-112 - - IgE from serum of patients allergic to crustaceans and mollusks - - - ELISA DOI:10.1046/j.1444-2906.2001.00344.x - Oct v 1 - QLEEAKWIAEDAD Sequential / Linear 147-159 - - IgE from serum of patients allergic to crustaceans and mollusks - - - ELISA DOI:10.1046/j.1444-2906.2001.00344.x - Oct v 1 - AISDELDQTFAEL Sequential / Linear 269-281 - - IgE from serum of patients allergic to crustaceans and mollusks - - - ELISA DOI:10.1046/j.1444-2906.2001.00344.x - Ole e 9 Ole e 9.0101 ATPTPT Sequential / Linear 360-365 2JON   99909 IgE from serum of patients allergic to O. europaea pollen extract - - - Western / Immunoblot 18096638 - Ole e 9 Ole e 9.0101 WCVPKPGVSD Sequential / Linear 372-381 2JON   100639 IgE from serum of patients allergic to O. europaea pollen extract - - - Western / Immunoblot 18096638 - Ole e 9 Ole e 9.0101 PIQPGGACFE Sequential / Linear 400-409 2JON   100380 IgE from serum of patients allergic to O. europaea pollen extract - - - Western / Immunoblot 18096638 - Ole e 9 Ole e 9.0101 RNSWNCD Sequential / Linear 430-436 2JON   100479 IgE from serum of patients allergic to O. europaea pollen extract - - - Western / Immunoblot 18096638 - Ora o AK - GIYAPDAEAYTL Sequential / Linear 66-77 - - IgE from Mantis shrimp-allergic patients sera - - - ELISA,Dot blot 37289596 Also an IgG-binding epitope Ora o AK - EDYHAGFKQTDKHPNKDFGD Sequential / Linear 87-106 - - IgE from Mantis shrimp-allergic patients sera - - - ELISA,Dot blot 37289596 Also an IgG-binding epitope Ora o AK - SMEGYPFNPCLTE Sequential / Linear 130-142 - - IgE from Mantis shrimp-allergic patients sera - - - ELISA,Dot blot 37289596 Also an IgG-binding epitope Ora o AK - EVQQKLIDDHFL Sequential / Linear 176-187 - - IgE from Mantis shrimp-allergic patients sera - - - ELISA,Dot blot 37289596 Also an IgG-binding epitope Ora o AK - RFLQAANACRFWP Sequential / Linear 193-205 - - IgE from Mantis shrimp-allergic patients sera - - - ELISA,Dot blot 37289596 Also an IgG-binding epitope Par j 1 Par j 1.0101 QGKEKEP Sequential / Linear 19-25 - 106977 IgE from serum of P judaica-allergic patients - - - Western / Immunoblot 12680870 - Par j 1 Par j 1.0101 SKGCCSGAKRLDG Sequential / Linear 26-37 - 106846 IgE from serum of P judaica-allergic patients - - - Western / Immunoblot 12680870 - Par j 1 Par j 1.0101 KTGPQRV Sequential / Linear 41-47 - 106578 IgE from serum of P judaica-allergic patients - - - Western / Immunoblot 12680870 - Par j 1 Par j 1.0101 PKHCGIVD Sequential / Linear 72-79 - 106407 IgE from serum of P judaica-allergic patients - - - Western / Immunoblot 12680870 - Par j 1 Par j 1.0101 PAHKARLE Sequential / Linear 118-125 - 106696 IgE from serum of P judaica-allergic patients - - - Western / Immunoblot 12680870 - Par j 2 Par j 2.0101 CLHFVK Sequential / Linear 45-50 - 106310 IgE from serum of P judaica-allergic patients - - - Western / Immunoblot 12680870 - Par j 2 Par j 2.0101 VKGEEKEPSK Sequential / Linear 49-58 - 106965 IgE from serum of P judaica-allergic patients - - - Western / Immunoblot 12680870 - Par j 2 Par j 2.0101 CSGTKKLSEE Sequential / Linear 61-70 - 106315 IgE from serum of P judaica-allergic patients - - - Western / Immunoblot 12680870 - Par j 2 Par j 2.0101 EEVKTTEQ Sequential / Linear 69-76 - 106378 IgE from serum of P judaica-allergic patients - - - Western / Immunoblot 12680870 - Par j 2 Par j 2.0101 KREACKCIVR Sequential / Linear 77-86 - 106574 IgE from serum of P judaica-allergic patients - - - Western / Immunoblot 12680870 - Par j 2 Par j 2.0101 CIVRATKGI Sequential / Linear 83-91 - 106306 IgE from serum of P judaica-allergic patients - - - Western / Immunoblot 12680870 - Par j 2 Par j 2.0101 KKCDIKTT Sequential / Linear 104-111 - 106562 IgE from serum of P judaica-allergic patients - - - Western / Immunoblot 12680870 - Par j 2 Par j 2.0101 SKIQSTIF Sequential / Linear 122-129 - 106848 IgE from serum of P judaica-allergic patients - - - Western / Immunoblot 12680870 - Pen a 1 Pen a 1.0101 AADESERMRKVLENRSLSDEERMDALENQL Sequential / Linear 119-148 - - IgE from serum of shrimp-allergic patients - - Major epitope Western / Immunoblot 10224419 - Pen a 1 Pen a 1.0101 FLAEEADRKYDEVARKLAMVEADLERA Sequential / Linear 153-179 - - IgE from serum of shrimp-allergic patients - - Major epitope Western / Immunoblot 10224419 - Pen a 1 Pen a 1.0101 FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS Sequential / Linear 241-282 - - IgE from serum of shrimp-allergic patients - - Major epitope Western / Immunoblot 10224419 - Pen c 13 Pen c 13.0101 ANVVQSNVPSWGLARISSK Sequential / Linear 116-134 - 164593 IgE from serum of mold allergic patients - - - Western / Immunoblot 22506037 - Pen c 13 Pen c 13.0101 VCTIAASTSTDGSASFTNFGSVVD Sequential / Linear 296-319 - 165416 IgE from serum of mold allergic patients - - - Western / Immunoblot 22506037 - Pen c 13 Pen c 13.0101 TNFGSVVDLYAPGQSITAAYPGGGSKTL Sequential / Linear 312-339 - 165352 IgE from serum of mold allergic patients - - - Western / Immunoblot 22506037 - Pen c 13 Pen c 13.0101 ALEGVSAGNACARIVQLATSSISRAPSGTTSK Sequential / Linear 358-389 - 164583 IgE from serum of mold allergic patients - - Immunodominant epitope Western / Immunoblot and Antigen Competition 22506037 - Pen c 13 Pen c 13.0101 STAGEGVVFYGVDTGIDISHSD Sequential / Linear 145-166 - 165281 IgE from serum of mold allergic patients - - - Western / Immunoblot 22506037 - Pen c 13 Pen c 13.0101 GVDTGIDISHSDF Sequential / Linear 155-167 - 164772 IgE from serum of mold allergic patients - - - Western / Immunoblot 22506037 - Pen c 13 Pen c 13.0101 WGTNVVDNDNTDGNGHGTHTASTAAGSK Sequential / Linear 173-200 - 165496 IgE from serum of mold allergic patients - - - Western / Immunoblot 22506037 - Pen c 13 Pen c 13.0101 YGVAK Sequential / Linear 201-205 - 165519 IgE from serum of mold allergic patients - - - Western / Immunoblot 22506037 - Pen c 13 Pen c 13.0101 VAVKVLGADGSGTNSGVISGMDW Sequential / Linear 210-232 - 165414 IgE from serum of mold allergic patients - - - Western / Immunoblot 22506037 - Pen c 13 Pen c 13.0101 VLGADGSGTNSGVISGMDWAVK Sequential / Linear 214-235 - 165449 IgE from serum of mold allergic patients - - - Western / Immunoblot 22506037 - Pen c 13 Pen c 13.0101 AKSRGANGKYVMNMSLGGE Sequential / Linear 237-255 - 164579 IgE from serum of mold allergic patients - - - Western / Immunoblot 22506037 - Pen c 13 Pen c 13.0101 AAANVVKSGIFLSVAAGNE Sequential / Linear 263-281 - 164560 IgE from serum of mold allergic patients - - Immunodominant epitope Western / Immunoblot and Antigen Competition 22506037 - Pen ch 13 Pen ch 13.0101 PSWGLSRISSK Sequential / Linear 124-134 - 49559 IgE from serum of bronchial asthma patients allergic to Pen ch 13.0101 - - - Phage display-Immunoblot 15663570 - Pen ch 13 Pen ch 13.0101 GHADFGGR Sequential / Linear 163-170 - 20109 IgE from serum of bronchial asthma patients allergic to Pen ch 13.0101 - - Major epitope Phage display-Immunoblot 15663570 - Pen ch 13 Pen ch 13.0101 IAGMDWAVKDSKSRGATGK Sequential / Linear 227-245 - - IgE from serum of bronchial asthma patients allergic to Pen ch 13.0101 - - - Phage display-Immunoblot 15663570 - Pen ch 13 Pen ch 13.0101 SFTNFGSVV Sequential / Linear 310-318 - 57928 IgE from serum of bronchial asthma patients allergic to Pen ch 13.0101 - - - Phage display-Immunoblot 15663570 - Pen ch 18 Pen ch 18.0101 GVDAYVIDTGANVKHVDFE Sequential / Linear 175-193 - 22932 IgE from serum of allergic patients with bronchial asthma - - - Western / Immunoblot 11964171 - Pen ch 18 Pen ch 18.0101 SGTIAGKKF Sequential / Linear 219-227 - 58258 IgE from serum of Pen ch 18.0101 allergic patients with bronchial asthma - - Immunodominant epitope Western / Immunoblot 18760997 - Pen ch 18 Pen ch 18.0101 EDGNGHGTHCSGTIAGKKFGVAK Sequential / Linear 209-231 - 11338 IgE from serum of patients with bronchial asthma - - Immunodominant epitope Western / Immunoblot 14510716 - Pen ch 18 Pen ch 18.0101 VIDTGANVKHVDFEGRANW Sequential / Linear 180-198 - 68931 IgE from serum of allergic patients with bronchial asthma - - Immunodominant epitope Western / Immunoblot 11964171 - Pen ch 18 Pen ch 18.0101 TIPQGDADEDGNGHGTHCSGTIAGK Sequential / Linear 201-225 - 64419 IgE from serum of allergic patients with bronchial asthma - - - Western / Immunoblot 11964171 - Pen ch 18 Pen ch 18.0101 RSNGSGTMSDVVKGVEW Sequential / Linear 242-258 - 55909 IgE from serum of allergic patients with bronchial asthma - - - Western / Immunoblot 11964171 - Pen ch 18 Pen ch 18.0101 AHIKKSKKGDKKFKGSVANMSLGGGSSRTLD Sequential / Linear 262-292 - 1777 IgE from serum of allergic patients with bronchial asthma - - - Western / Immunoblot 11964171 - Pen ch 18 Pen ch 18.0101 ILSTWVGSDHATNTISGTSMA Sequential / Linear 358-378 - 27368 IgE from serum of allergic patients with bronchial asthma - - - Western / Immunoblot 11964171 - Pen ch 18 Pen ch 18.0101 AVADVTPKQL Sequential / Linear 401-410 - 5247 IgE from serum of allergic patients with bronchial asthma - - - Western / Immunoblot 11964171 - Pen ch 18 Pen ch 18.0101 KAALISVATEGTLTDIPSDTPNL Sequential / Linear 411-434 - 29753 IgE from serum of allergic patients with bronchial asthma - - - Western / Immunoblot 11964171 - Pen ch 18 Pen ch 18.0101 GTLTDIPSDTPNLLAWNGGGSANYTKILADGGY Sequential / Linear 421-453 - 22751 IgE from serum of allergic patients with bronchial asthma - - - Western / Immunoblot 11964171 - Pen i 1 Pen i 1.0101 MQQLENDLDQVQESLLK Sequential / Linear 50-66 - 42400 IgE from serum of patients allergic to shrimp - - - Western / Immunoblot and Antigen Competition 7693809 - Pen i 1 Pen i 1.0101 FLAEEADRK Sequential / Linear 153-161 - 16496 IgE from serum of patients allergic to shrimp - - - Western / Immunoblot and Antigen Competition 7693809 - Pen m 1 Pen m 1.0101 NRRIQLLEEDLERSEER Sequential / Linear 89-105 - 153863 IgE from serum of shrimp allergic patients - - Major epitope Antigen Competition 21802470 - Pen m 1 Pen m 1.0101 EASQAADESERMRK Sequential / Linear 115-128 - 153821 IgE from serum of shrimp allergic patients - - Major epitope Antigen Competition 21802470 - Pen m 1 Pen m 1.0101 ENRSLSDEERMD Sequential / Linear 131-142 - 153826 IgE from serum of shrimp allergic patients - - Major epitope Antigen Competition 21802470 - Pen m 1 Pen m 1.0101 ENQLKEARFLAEEADRKYDE Sequential / Linear 145-164 - 153825 IgE from serum of shrimp allergic patients - - Major epitope Antigen Competition 21802470 - Pen m 1 Pen m 1.0101 ERAEERAETGESKI Sequential / Linear 177-190 - 153828 IgE from serum of shrimp allergic patients - - Major epitope Antigen Competition 21802470 - Pen m 1 Pen m 1.0101 SEEKANQREEAYKEQ Sequential / Linear 210-224 - 153886 IgE from serum of shrimp allergic patients - - Major epitope Antigen Competition 21802470 - Pen m 1 Pen m 1.0101 ERSVQKLQKEVDRLEDE Sequential / Linear 243-259 - 153829 IgE from serum of shrimp allergic patients - - Major epitope Antigen Competition 21802470 - Pen m 1 Pen m 1.0101 EKEKYKSITDELDQTFSE Sequential / Linear 263-280 - 153824 IgE from serum of shrimp allergic patients - - Major epitope Antigen Competition 21802470 - Per a 1 Per a 1.0104 LIRALFGL Sequential / Linear 78-85 - 36679 IgE from serum of patients sensitive to american cockroach - - Major epitope ELISA and Antigen Competition 12413697 - Per a 1 Per a 1.0104 IRSWFGLP Sequential / Linear 267-274 - 28405 IgE from serum of patients sensitive to american cockroach - - Major epitope ELISA and Antigen Competition 12413697 - Per a 1 Per a 1.0105 QDLLQNLRDKGV Sequential / Linear 97-108 - 228647 rPer a 1.0105-specific monoclonal antibody - - - Phage Display-ELISA 24991456 - Per a 10 Per a 10.0101 CAEQGYPGVYS Sequential / Linear 230-240 - 566773 IgE from serum of cockroach hypersensitive patients - - - ELISA 27792882 - Per a 10 Per a 10.0101 QQGGKDACQGDSG Sequential / Linear 199-211 - 566886 IgE from serum of cockroach hypersensitive patients - - - ELISA 27792882 - Per a 10 Per a 10.0101 SRSECNQAYSDY Sequential / Linear 175-186 - 566915 IgE from serum of cockroach hypersensitive patients - - - ELISA 27792882 - Per a 2 Per a 2.0101 DTSSYTTVIPSASCVSGGCNCANVHKYYSN Sequential / Linear 57-86 - - IgE from serum of Per a 2-allergic patients and Rabbit anti-Per a 2 antibody - - - ELISA 25749772 - Per a 2 Per a 2.0101 YYRGDFTYVPLV Sequential / Linear 200-211 - 422137 IgE from serum of Per a 2-allergic patients and Rabbit anti-Per a 2 antibody - - - ELISA 25749772 - Per a 2 Per a 2.0101 TYHIQQNGDLC Sequential / Linear 299-309 - 422100 IgE from serum of Per a 2-allergic patients and Rabbit anti-Per a 2 antibody - - - ELISA 25749772 - Per a 3 Per a 3.0101 TVLRDPVFYQ Sequential / Linear 400-409 - 67076 IgE from serum of patients allergic to cockroach extract - - - ELISA and Antigen Competition 14510715 - Per a 3 Per a 3.0101 NNVDQI Sequential / Linear 466-471 - 45279 IgE from serum of patients allergic to cockroach extract - - - ELISA and Antigen Competition 14510715 - Per a 3 Per a 3.0101 VDKGHNYCGYPENLLI Sequential / Linear 580-595 - 67994 IgE from serum of patients allergic to cockroach extract - - - ELISA and Antigen Competition 14510715 - Per a 3 Per a 3.0101 IPKGKKGGQAY Sequential / Linear 595-605 - 27895 IgE from serum of patients allergic to cockroach extract - - - ELISA and Antigen Competition 14510715 - Per a 5 Per a 5.0102 MTIDFYYLPGSAPCRSVLLA Sequential / Linear 1-20 - 742372 IgE from serum of American cockroach allergic patients - - - ELISA 29323160 - Per a 5 Per a 5.0102 GFCLWESRAILSYLADQYGK Sequential / Linear 61-80 - 742320 IgE from serum of American cockroach allergic patients - - - ELISA 29323160 - Per a 5 Per a 5.01B VTNLMAGEHLTPEFLK Sequential / Linear 32-47 - 1642391 IgE from serum of cockroach sensitive patients - - - ELISA 34717182 - Per a 5 Per a 5.01B QYGKDDSLYRRDAKKR Sequential / Linear 77-92 - 1640648 IgE from serum of cockroach sensitive patients - - - ELISA 34717182 - Per a 5 Per a 5.01B YYPIYFAKQAADPEKMKKLEEA Sequential / Linear 114-135 - 1642848 IgE from serum of cockroach sensitive patients - - - ELISA 34717182 - Pha v PHA-E - NVNDNGEPTLSS Sequential / Linear 55-66 - 850860 - - - ELISA 30223257 UniProtKB: V5QN77 Pha v PHA-E - VGSEPKDKGG Sequential / Linear 116-125 - 850891 - - - ELISA 30223257 UniProtKB: V5QN77 Pha v PHA-E - NNYKYDSNAHT Sequential / Linear 131-141 - 850858 - - - ELISA 30223257 UniProtKB: V5QN77 Pha v PHA-E - LYNVHWDPKPRH Sequential / Linear 149-160 - 850841 - - - ELISA 30223257 UniProtKB: V5QN77 Phl p 1 Phl p 1.0102 APYHFDLSGHAFGAM Sequential / Linear 124-138 1N10   3912 IgE from serum of grass pollen allergic patients - - Immunodominant IgE hapten Western / Immunoblot 7525573 - Pin p 1 Pin p 1.0101 QRRREQPS Sequential / Linear 61-68 - 1309258 Sera from Pine nut allergic patients - - - Microarray 32866706 - Pin p 1 Pin p 1.0101 ERCCEEL Sequential / Linear 69-75 - 1309201 Sera from Pine nut allergic patients - - - Microarray 32866706 - Pin p 1 Pin p 1.0101 NQRRRRR Sequential / Linear 112-118 - 1309246 Sera from Pine nut allergic patients - - - Microarray 32866706 - Pin p 1 Pin p 1.0101 LPNRCNL Sequential / Linear 136-142 - 1309234 Sera from Pine nut allergic patients - - - Microarray 32866706 - Pin p 1 Pin p 1.0101 RESPRRCDIRR Sequential / Linear 143-153 - 1309269 Sera from Pine nut allergic patients - - - Microarray 32866706 - Pis s PsA - TETTSFLITKFSPDQ Sequential / Linear 31-45 1BQP  1HKD  1RIN  1OFS  2LTN  2BQP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Pis s PsA - AHEVLSWSFHSELSGTSSSKQ Sequential / Linear 250-271 - - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Pis s PsA - GDSYTTKEKLTLTKAVKNTVGRAL Sequential / Linear 52-75 1BQP  1HKD  1RIN  1OFS  2LTN  2BQP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Pis s PsA - GNVANFVTS Sequential / Linear 88-96 1BQP  1HKD  1RIN  1OFS  2LTN  2BQP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Pis s PsA - SYNVADGFTFFI Sequential / Linear 106-117 1BQP  1HKD  1RIN  1OFS  2LTN  2BQP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Pis s PsA - VFNSAEYDK Sequential / Linear 133-141 1BQP  1HKD  1RIN  1OFS  2LTN  2BQP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Pis s PsA - DTFYNAAWDPSN Sequential / Linear 151-162 1BQP  1HKD  1RIN  1OFS  2LTN  2BQP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Pis s PsA - IDVNSIKSVNTKSWKLQNGEE Sequential / Linear 169-189 1BQP  1HKD  1RIN  1OFS  2LTN  2BQP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Pis s PsA - VLTVSLTYPNVT Sequential / Linear 202-213 2BQP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Pis s PsA - LKDVVPEW Sequential / Linear 229-236 2BQP   - IgE from serum of peanut-allergic patients - - - Western / Immunoblot 20541807 - Pis v 1 Pis v 1.0101 SGQSCQKQFEEQQKFKHCQMY Sequential / Linear 35-56 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 1 Pis v 1.0101 EVQKSQDGHSLTARINQR Sequential / Linear 60-77 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 1 Pis v 1.0101 CCQELQEVDKKCRCQNLEQMVKRQ Sequential / Linear 84-107 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 1 Pis v 1.0101 KLQELYETASELPRM Sequential / Linear 117-131 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 2 Pis v 2 SEAGVTEFWDQNEEQLQC Sequential / Linear 59-76 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 2 Pis v 2 ISVMRGLPLDVIQNSFDISREDAWNLKESRSEMTIF Sequential / Linear 426-461 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 2 Pis v 2 QGSGIHGAVFPGCPETFQEES Sequential / Linear 107-127 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 2 Pis v 2 EQHQKVRHIREGDIIALPAGV Sequential / Linear 146-166 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 2 Pis v 2 NGQSKLVLVALADVGNSE Sequential / Linear 173-190 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 2 Pis v 2 FVLGGSPQQEIQGGGQSW Sequential / Linear 200-217 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 2 Pis v 2 RSSRKGQQSNNILSAFDE Sequential / Linear 221-238 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 2 Pis v 2 KEDLQVLSPQRQEKEYSDNGLEETFCT Sequential / Linear 269-295 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 2 Pis v 2 SIVYITRGNGRMQIVSENGESVFDEEIREGQLV Sequential / Linear 357-389 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 2 Pis v 2 QNFAVVKRASSDGFEWVS Sequential / Linear 393-410 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 3 Pis v 3.0101 EQCAKGCEKYYKEKKGRE Sequential / Linear 51-68 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 3 Pis v 3.0101 MKQCERQDGGQQKQLCRFRCQEKYKKERREHSYS Sequential / Linear 105-134 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 3 Pis v 3.0101 TKRSKLLRGLEKYRLAFL Sequential / Linear 180-197 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 3 Pis v 3.0101 FFVSWGRGTITKIRENKRES Sequential / Linear 216-235 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 3 Pis v 3.0101 MNVKQGDIIRIRAGTPFYI Sequential / Linear 236-254 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 3 Pis v 3.0101 IVKASKEQIRAMSRRGE Sequential / Linear 324-340 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 3 Pis v 3.0101 GPSIWPFTGK Sequential / Linear 341-350 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 3 Pis v 3.0101 NITKGGMSGPFYNSRATK Sequential / Linear 393-410 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Pis v 3 Pis v 3.0101 KNSGQEKSGPSYKKLSSSIRTDSV Sequential / Linear 432-455 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 - Poa p 5 Poa p 5.0101 AAVDSSKAALTSKLDAAYKL Sequential / Linear 111-130 - 481 IgE from pooled serum of grass-allergic patients - - - ELISA 8698392 UniProtKB:P22286 Poa p 5 Poa p 5.0101 SQAQKAAKPAAAATGTATAA Sequential / Linear 271-290 - 60374 IgE from pooled serum of grass-allergic patients - - - ELISA 8698392 UniProtKB:P22286 Poa p 5 Poa p 5.0101 AEEVKATPAGELQVIDKVDA Sequential / Linear 171-190 - 895 IgE from pooled serum of grass-allergic patients - - - ELISA 8698392 UniProtKB:P22286 Poa p 5 Poa p 5.0101 AFKVAATAANAAPANDKFTV Sequential / Linear 191-210 - 1336 IgE from pooled serum of grass-allergic patients - - - ELISA 8698392 UniProtKB:P22286 Poa p 5 Poa p 5.0101 AAPANDKFTVFEAAFNDAIK Sequential / Linear 201-220 - 346 IgE from pooled serum of grass-allergic patients - - - ELISA 8698392 UniProtKB:P22286 Poa p 5 Poa p 5.0101 ASTGGAYQSYKFIPALEAAV Sequential / Linear 221-240 - 4792 IgE from pooled serum of grass-allergic patients - - - ELISA 8698392 UniProtKB:P22286 Poa p 5 Poa p 5.0101 KFIPALEAAVKQSYAATVAT Sequential / Linear 231-250 - 30748 IgE from pooled serum of grass-allergic patients - - - ELISA 8698392 UniProtKB:P22286 Poa p 5 Poa p 5.0101 KQSYAATVATAPAVKYTVFE Sequential / Linear 241-260 - 33077 IgE from pooled serum of grass-allergic patients - - - ELISA 8698392 UniProtKB:P22286 Poa p 5 Poa p 5.0101 APAVKYTVFETALKKAITAM Sequential / Linear 251-270 - 3493 IgE from pooled serum of grass-allergic patients - - - ELISA 8698392 UniProtKB:P22286 Poa p 5 Poa p 5.0101 TALKKAITAMSQAQKAAKPA Sequential / Linear 261-280 - 62912 IgE from pooled serum of grass-allergic patients - - - ELISA 8698392 UniProtKB:P22286 Poly p 5 Poly p 5.0102 VGHYTQVVWAKTKE Sequential / Linear 157-170 - - IgE from pooled serum of patients allergic to P paulista venom - - Major epitope ELISA, Western / Immunoblot 25129676 - Pru ar 3 Pru ar 3.0101 YVRGGGAVP Sequential / Linear 16-24 - 76396 IgE from pooled serum of patients allergic to Rosaceae fruits - - - Western / Immunoblot 18036340 - Pru ar 3 Pru ar 3.0101 LARTTPDRRTACNCL Sequential / Linear 37-51 - 54951 IgE from pooled serum of patients allergic to Rosaceae fruits - - - Western / Immunoblot 18036340 - Pru ar 3 Pru ar 3.0101 NNAAAL Sequential / Linear 64-69 - 70153 IgE from pooled serum of patients allergic to Rosaceae fruits - - - Western / Immunoblot 18036340 - Pru ar 3 Pru ar 3.0101 NIPYKISASTNCATVK Sequential / Linear 76-91 - 44314 IgE from pooled serum of patients allergic to Rosaceae fruits - - - Western / Immunoblot 18036340 - Pru d 3 Pru d 3.0101 YVKGGGAVP Sequential / Linear 100-108 - 76310 IgE from pooled serum of patients allergic to Rosaceae fruits - - - Western / Immunoblot 18036340 - Pru d 3 Pru d 3.0101 LARTTADRRAACNCLKQL Sequential / Linear 37-54 - 34950 IgE from pooled serum of patients allergic to Rosaceae fruits - - - Western / Immunoblot 18036340 - Pru d 3 Pru d 3.0101 NNAAAL Sequential / Linear 64-69 - 70153 IgE from pooled serum of patients allergic to Rosaceae fruits - - - Western / Immunoblot 18036340 - Pru d 3 Pru d 3.0101 NVPYKISASTNCATVK Sequential / Linear 76-91 - 46455 IgE from pooled serum of patients allergic to Rosaceae fruits - - - Western / Immunoblot 18036340 - Pru du 6 Pru du 6.0101 SSQQGRQQEQEQERQ Sequential / Linear 118-132 - 156272 IgE from pooled serum of almond-allergic patients - - - Immunoblot(Antigen Competition) 21720172 - Pru du 6 Pru du 6.0101 QQEQQQERQGRQQGR Sequential / Linear 145-159 - 156426 IgE from pooled serum of almond-allergic patients - - - Immunoblot(Antigen Competition) 21720172 - Pru du 6 Pru du 6.0101 QQEEGRQQEQQQGQQ Sequential / Linear 161-175 - 156424 IgE from pooled serum of almond-allergic patients - - - Immunoblot(Antigen Competition) 21720172 - Pru du 6 Pru du 6.0101 LFHVSSDHNQLDQNP Sequential / Linear 225-239 3FZ3  3EHK   156358 IgE from pooled serum of almond-allergic patients - - - Immunoblot(Antigen Competition) 21720172 - Pru du 6 Pru du 6.0101 QQEQQGSGNNVFSGF Sequential / Linear 281-295 - 156425 IgE from pooled serum of almond-allergic patients - - - Immunoblot(Antigen Competition) 21720172 - Pru du 6 Pru du 6.0101 RALPDEVLANAYQIS Sequential / Linear 510-524 3FZ3  3EHK   156448 IgE from pooled serum of almond-allergic patients - - - Immunoblot(Antigen Competition) 21720172 - Pru du 6 Pru du 6.0201 FGQNKEWQLNQLEAR Sequential / Linear 17-31 - 156291 IgE from pooled serum of almond-allergic patients - - - Immunoblot(Antigen Competition) 21720172 - Pru du 6 Pru du 6.0201 DSQPQQFQQQQQQQQ Sequential / Linear 105-119 - 156260 IgE from pooled serum of almond-allergic patients - - - Immunoblot(Antigen Competition) 21720172 - Pru du 6 Pru du 6.0201 RPSRQEGGQGQQQFQ Sequential / Linear 121-135 - 156444 IgE from pooled serum of almond-allergic patients - - - Immunoblot(Antigen Competition) 21720172 - Pru du 6 Pru du 6.0201 QNQLDQVPRRFYLAG Sequential / Linear 185-199 - 156423 IgE from pooled serum of almond-allergic patients - - - Immunoblot(Antigen Competition) 21720172 - Pru du 6 Pru du 6.0201 QQGRQQQQQQQGQQG Sequential / Linear 209-223 - 156427 IgE from pooled serum of almond-allergic patients - - - Immunoblot(Antigen Competition) 21720172 - Pru du 6 Pru du 6.0201 GNNIFSGFDTQLLAQ Sequential / Linear 225-239 - 156317 IgE from pooled serum of almond-allergic patients - - - Immunoblot(Antigen Competition) 21720172 - Pru du 6 Pru du 6.0201 RGDQERQQEEQQSQR Sequential / Linear 281-295 - 156435 IgE from pooled serum of almond-allergic patients - - - Immunoblot(Antigen Competition) 21720172 - Pru du 6 Pru du 6.0201 QNAFRISRQEARNLK Sequential / Linear 465-479 - 156421 IgE from pooled serum of almond-allergic patients - - - Immunoblot(Antigen Competition) 21720172 - Pru p 3 Pru p 3.0101 RNVNNLARTT Sequential / Linear 32-41 2ALG  2B5S   - IgE from serum of patients with baker’s asthma - - - Western / Immunoblot 19846220 Tri a 14 homologous epitope Pru p 3 Pru p 3.0101 ITCGQVSSSLAPCIPYVRGG Sequential / Linear 1-20 2ALG  2B5S   2140550 IgE from peach allergic patients - - - Microarray 35935018 - Pru p 3 Pru p 3.0101 SSSLAPCIPYVRGGGAVPPA Sequential / Linear 7-26 2ALG  2B5S   2143446 IgE from peach allergic patients - - - Microarray 35935018 - Pru p 3 Pru p 3.0101 VNPNNAAALPGKCGVSIPYK Sequential / Linear 61-80 2ALG  2B5S   2144177 IgE from peach allergic patients - - - Microarray 35935018 - Pru p 3 Pru p 3.0101 PGKCGVSIPYKISASTNCAT Sequential / Linear 70-89 2ALG  2B5S   2142002 IgE from peach allergic patients - - - Microarray 35935018 - Pru p 3 Pru p 3.0101 KCGVHIPYKISASTNCATVK Sequential / Linear 72-91 2ALG  2B5S   3502 IgE from serum of patients with baker’s asthma - - - Western / Immunoblot 19846220 Tri a 14 homologous epitope Pru p 3 Pru p 3.0101 APCIPYVRGG Sequential / Linear 11-20 2ALG  2B5S   3502 IgE from pooled serum of patients allergic to peach - - Major epitope Western / Immunoblot 13679821 - Pru p 3 Pru p 3.0101 IRNVNNLARTTPDRQ Sequential / Linear 31-45 2ALG  2B5S   ( ! ) Deprecated: Function split() is deprecated in C:\wamp\www\AllerBase\PHP_codes\BrSeqEpi.php on line 606 Call Stack # Time Memory Function Location 1 0.0432 791368 {main}( ) ..\BrSeqEpi.php:0 28349 44654 IgE from pooled serum of patients allergic to peach - - Major epitope Western / Immunoblot 13679821 - Pru p 3 Pru p 3.0101 GKCGVSIPYK Sequential / Linear 71-80 2ALG  2B5S   20523 IgE from pooled serum of patients allergic to peach - - Major epitope Western / Immunoblot 13679821 - Pru p 3 Pru p 3.0101 RTTPDRQAA Sequential / Linear 39-47 - 56195 IgE from patients allergic to fruit nsLTPs - - - ELISA 17059861 - Pru p 3 Pru p 3.0101 ITCGQVSSALAPCIPY Sequential / Linear 1-16 - 137538 IgE from peach allergic patients - - Major epitope Immune Slot-blot Microarray 35749217 - Pru p 3 Pru p 3.0101 PCIPYVRGGGAVPPAC Sequential / Linear 12-27 2ALG  2B5S   137550 IgE from peach allergic patients - - Major epitope Immune Slot-blot Microarray 35749217 - Pru p 3 Pru p 3.0101 VPPACCNGIRNVNNLA Sequential / Linear 23-38 2ALG  2B5S   137582 IgE from peach allergic patients - - Major epitope Immune Slot-blot Microarray 35749217 - Pru p 3 Pru p 3.03 IQAGLAPCLGYLQRG Sequential / Linear 31-45 - - Sera of peanut allergic patients from USA - - - Microarray,Fluorescence immunoassay 36698378 - Pru p 3 Pru p 3.03 GVPAGGCCPGIKRLV Sequential / Linear 46-60 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Pru p 3 Pru p 3.03 AAALPSLCGVKIPYK Sequential / Linear 91-105 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Pru p 3 Pru p 3.03 SLCGVKIPYKISAST Sequential / Linear 96-110 - - Sera of peanut allergic patients from USA & Spain - - - Microarray,Fluorescence immunoassay 36698378 - Rap v 2 Rap v 2.0101 VRKVSRTYNVYRGSSPST Sequential / Linear 10-27 - - Sera from sea-snail-allergic patients - - - Dot blot 33929822 - Rap v 2 Rap v 2.0101 ESRIRELEDALDSERD Sequential / Linear 32-47 - - Sera from sea-snail-allergic patients - - - Dot blot 33929822 - Rap v 2 Rap v 2.0101 DQLQDSLDEQGTSTSAQM Sequential / Linear 64-81 - - Sera from sea-snail-allergic patients - - - Dot blot 33929822 - Rap v 2 Rap v 2.0101 EATESSMRKRH Sequential / Linear 106-116 - - Sera from sea-snail-allergic patients - - - Dot blot 33929822 - Rap v 2 Rap v 2.0101 TSTNLRNQLSKVNADYS Sequential / Linear 273-289 - - Sera from sea-snail-allergic patients - - - Dot blot 33929822 - Rap v 2 Rap v 2.0101 DLTKRNRQLENENA Sequential / Linear 361-374 - - Sera from sea-snail-allergic patients - - - Dot blot 33929822 - Rap v 2 Rap v 2.0101 DMENRLREKDEE Sequential / Linear 491-502 - - Sera from sea-snail-allergic patients - - - Dot blot 33929822 - Rhi o 1 Rhi o 1.0101 TGEYLTQKYFNSQRNN Sequential / Linear 44-59 - 549251 IgE from serum of mold-allergic patients - - - ELISA 27358405 - Rhi o 1 Rhi o 1.0101 GAEKNWAGQYVVDCNK Sequential / Linear 311-326 - 549154 IgE from serum of mold-allergic patients - - - ELISA 27358405 - Rhi o 2 Rhi o 2.0101 NKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFITTIKCSWLDGKHVVFGRVTEGMDVVQNIESLGSPN Sequential / Linear 81-149 - - Sera from patients with fungal - - - Immunoblot, Mutagenesis 31882546 Fragment contaning site of IgE recognition and cross-reactivity Ric c 1 Ric c 1.0101 ESKGEREGSSSQQCR Sequential / Linear 36-50 1PSY   - IgE from serum of Castor bean allergic patients - - - Western / Immunoblot and mast cell degranulation assay 18262682 - Ric c 1 Ric c 1.0101 QEVQRKDLSSCERYLRQSSS Sequential / Linear 51-70 1PSY   - IgE from serum of Castor bean allergic patients - - - Western / Immunoblot and mast cell degranulation assay 18262682 - Ric c 1 Ric c 1.0101 DECQCEAIKYIAEDQQGQ Sequential / Linear 105-123 1PSY   - IgE from serum of Castor bean allergic patients - - - Western / Immunoblot and mast cell degranulation assay 18262682 - Ric c 1 Ric c 1.0101 LHGEESERVAQRAGE Sequential / Linear 125-140 1PSY   - IgE from serum of Castor bean allergic patients - - - Western / Immunoblot and mast cell degranulation assay 18262682 - Ric c 1 Ric c 1.0101 QEQQNLRQCQEYIKQ Sequential / Linear 167-181 - - IgE from serum of Castor bean allergic patients - - - Western / Immunoblot and mast cell degranulation assay 18262682 - Ric c 1 Ric c 1.0101 EGLRQAIEQQQSQGQ Sequential / Linear 215-229 - - IgE from serum of Castor bean allergic patients - - Immunodominant epitope Western / Immunoblot and mast cell degranulation assay 18262682 - Sal s 1 Sal s 1.0101 MACAHLCKEADIKTALEA Sequential / Linear 1-18 - 159002 Serum of fish-allergic patients with specific IgE to salmon parvalbumin - - - ELISA 21894026 - Sal s 1 Sal s 1.0101 KTFFHTIGFASKSADDVK Sequential / Linear 28-45 - 158933 Serum of fish-allergic patients with specific IgE to salmon parvalbumin - - - ELISA 21894026 - Sal s 1 Sal s 1.0101 VEELKLFLQNFCPKARELTDA Sequential / Linear 61-81 - 159180 Serum of fish-allergic patients with specific IgE to salmon parvalbumin - - - ELISA 21894026 - Sal s 1 Sal s 1.0101 ACAHLCK Sequential / Linear 2-8 - 910682 Sera from healthy and fish allergic patients - - - ELISA 30974223 - Sal s 1 Sal s 1.0101 FAVLVKQ Sequential / Linear 103-109 - 910721 Sera from healthy and fish allergic patients - - - ELISA 30974223 - Sch j Sj22 - DTDKDGKVSLEEFCR Sequential / Linear 56-70 - 10312 IgE from pooled serum of individuals infected with S. japonicum - - - Western / Immunoblot 9784652 - Sch j Sj22 - LKKDKEGKVSTLPLD Sequential / Linear 86-100 - 36903 IgE from pooled serum of individuals infected with S. japonicum - - - Western / Immunoblot 9784652 - Sch j Sj22 - MSKAKQYNICCKFKE Sequential / Linear 108-122 - 42580 IgE from pooled serum of individuals infected with S. japonicum - - - Western / Immunoblot 9784652 - Sch j Sj22 - FKYSNYVCLLWRTPS Sequential / Linear 176-190 - 16487 IgE from pooled serum of individuals infected with S. japonicum - - - Western / Immunoblot 9784652 - Sco j 1 - AGSFDHKKFFKACGLSGKST Sequential / Linear 22-41 5XND   - IgE from serum of fish-allergic patients - - - Fluorescence ELISA DOI:10.1016/j.foodchem.2008.04.062 - Scy p 1 Scy p 1.0101 KIVELEEELRVVGNNLKSLEVS Sequential / Linear 189-210 - 2144619 IgE from crab allergic patients - - - Dot blot 36110087 UniProtKB:A0A6C0N3G5 Scy p 1 Scy p 1.0101 EEKANQREETYKEQIKTLANK Sequential / Linear 211-231 - 2144618 IgE from crab allergic patients - - - Dot blot 36110087 UniProtKB:A0A6C0N3G5 Scy p 1 Scy p 1.0101 AQEQLSAANTKL Sequential / Linear 60-71 - 2144611 IgE from crab allergic patients - - - Dot blot 36110087 UniProtKB:A0A6C0N3G5 Scy p 1 Scy p 1.0101 ALQNAEGEVAALNR Sequential / Linear 77-90 - 2144610 IgE from crab allergic patients - - - Dot blot 36110087 UniProtKB:A0A6C0N3G5 Scy p 1 Scy p 1.0101 RSEERLNTAT Sequential / Linear 101-110 - 2144630 IgE from crab allergic patients - - - Dot blot 36110087 UniProtKB:A0A6C0N3G5 Scy p 1 Scy p 1.0101 LAEASQAADESER Sequential / Linear 113-125 - 2144620 IgE from crab allergic patients - - - Dot blot 36110087 UniProtKB:A0A6C0N3G5 Scy p 1 Scy p 1.0101 MRKVLENRSLSDEE Sequential / Linear 126-139 - 2144626 IgE from crab allergic patients - - - Dot blot 36110087 UniProtKB:A0A6C0N3G5 Scy p 1 Scy p 1.0101 RMDALENQLKEARFLAEEADRKY Sequential / Linear 140-162 - 2144629 IgE from crab allergic patients - - - Dot blot 36110087 UniProtKB:A0A6C0N3G5 Scy p 1 Scy p 1.0101 DEVARKLAMVEAD Sequential / Linear 163-175 - 2144617 IgE from crab allergic patients - - - Dot blot 36110087 UniProtKB:A0A6C0N3G5 Scy p 1 Scy p 1.0101 LERAEERAESGES Sequential / Linear 176-188 - 2144622 IgE from crab allergic patients - - - Dot blot 36110087 UniProtKB:A0A6C0N3G5 Scy p 2 Scy p 2.0101 CGRSMEGYPFNPCLT Sequential / Linear 123-137 - 189207 IgE from serum of crab allergic patients - - - Western / Immunoblot 23911402 - Scy p 2 Scy p 2.0101 TEAQYKEMESKVSST Sequential / Linear 137-151 - 189302 IgE from serum of crab allergic patients - - - Western / Immunoblot 23911402 - Scy p 2 Scy p 2.0101 YHNDNKTFLVWCNEE Sequential / Linear 207-221 - 189308 IgE from serum of crab allergic patients - - - Western / Immunoblot 23911402 - Scy p 2 Scy p 2.0101 VDPDGKFVISTRVRC Sequential / Linear 109-123 - 418896 IgE from serum of crab allergic patients - - - Dot blot and Degranulation assay 25728640 - Scy p 3 Scy p 3.0101 ARDVERAKFAFSIYDFEG Sequential / Linear 7-24 - 2144612 IgE from crab allergic patients - - - Dot blot 36110087 - Scy p 3 Scy p 3.0101 DCLRALNLNPTLAVIE Sequential / Linear 35-50 - 2144614 IgE from crab allergic patients - - - Dot blot 36110087 - Scy p 3 Scy p 3.0101 KVGGKTKKKEK Sequential / Linear 51-61 - 933435 IgE from crab allergic patients - - - Dot blot 36110087 - Scy p 3 Scy p 3.0101 DDFLPIFAQVKKDKDAGSFEDF Sequential / Linear 66-67 - 2144615 IgE from crab allergic patients - - - Dot blot 36110087 - Scy p 3 Scy p 3.0101 KTENGTMLYAE Sequential / Linear 96-106 - 933433 IgE from crab allergic patients - - - Dot blot 36110087 - Scy p 3 Scy p 3.0101 LEHILLSLGERLEKSELEP Sequential / Linear 107-125 - 2144621 IgE from crab allergic patients - - - Dot blot 36110087 - Scy p 3 Scy p 3.0101 DEDGFIPYEPFLK Sequential / Linear 135-147 - 933347 IgE from crab allergic patients - - - Dot blot 36110087 - Scy p 4 Scy p 4.0101 QVTVDEFKQAVKNLCC Sequential / Linear 76-91 7WBO   1813887 Sera from carb-allergic patients - - - Dot blot, ELISA 34689550 - Scy p 4 Scy p 4.0101 KTIDINGDGLVGVDE Sequential / Linear 111-125 7WBO   1781363 Sera from carb-allergic patients - - - Dot blot, ELISA 34689550 - Scy p 4 Scy p 4.0101 AFSSVKEIDD Sequential / Linear 135-144 7WBO   1718988 Sera from carb-allergic patients - - - Dot blot, ELISA 34689550 - Scy p 9 Scy p 9.0101 GTNRQTERIKRQREAVPL Sequential / Linear 336-353 7VZO   1861496 Sera of patients allergic to crab - - - Dot blot, ELISA 35040643 - Scy p 9 Scy p 9.0101 TFKLPGISPFDLGAT Sequential / Linear 363-377 7VZO   1862499 Sera of patients allergic to crab - - - Dot blot, ELISA 35040643 - Scy p 9 Scy p 9.0101 EMHIPGSPFQFTVGPL Sequential / Linear 418-433 7VZO   1861245 Sera of patients allergic to crab - - - Dot blot, ELISA 35040643 - Scy p 9 Scy p 9.0101 PGLERGEQGMPNEFNVW Sequential / Linear 446-462 7VZO   1862121 Sera of patients allergic to crab - - - Dot blot, ELISA 35040643 - Scy p 9 Scy p 9.0101 DGSCYVSYVVAEPGEY Sequential / Linear 490-505 7VZO   1861130 Sera of patients allergic to crab - - - Dot blot, ELISA 35040643 - Scy p 9 Scy p 9.0101 NDKHIPDSPYKVYITPS Sequential / Linear 512-528 7VZO   1862044 Sera of patients allergic to crab - - - Dot blot, ELISA 35040643 - Scy s Trp - RATQKKMQQVEN Sequential / Linear 44-55 - - IgE from serum of crab-allergic patients - - - ELISA / Blot 30107732 - Ses i 2 Ses i 2.0101 SRQCQMRHCM Sequential / Linear 46-55 - - IgE from serum of sesame allergic patients - - Immunodominant epitope Western / Immunoblot 15536424 - Ses i 2 Ses i 2.0101 QCQMRHCMQW Sequential / Linear 48-57 - 50419 IgE from serum of sesame allergic patients - - Immunodominant epitope Western / Immunoblot 15536424 - Ses i 2 Ses i 2.0101 CMQWMRSMRG Sequential / Linear 54-63 - 6663 IgE from serum of sesame allergic patients - - - Western / Immunoblot 15536424 - Ses i 2 Ses i 2.0101 EANQGQFEHF Sequential / Linear 74-83 - 11149 IgE from serum of sesame allergic patients - - - Western / Immunoblot 15536424 - Ses i 2 Ses i 2.0101 NQGQFEHFREC Sequential / Linear 76-86 - 45561 IgE from serum of sesame allergic patients - - Immunodominant epitope Western / Immunoblot 15536424 - Ses i 2 Ses i 2.0101 GQFEHFRECC Sequential / Linear 78-87 - 21860 IgE from serum of sesame allergic patients - - - Western / Immunoblot 15536424 - Ses i 2 Ses i 2.0101 FEHFRECCNE Sequential / Linear 80-89 - 15547 IgE from serum of sesame allergic patients - - - Western / Immunoblot 15536424 - Ses i 2 Ses i 2.0101 HFRECCNEIR Sequential / Linear 82-91 - 23863 IgE from serum of sesame allergic patients - - - Western / Immunoblot 15536424 - Ses i 2 Ses i 2.0101 RECCNEIRDVK Sequential / Linear 84-94 - 53464 IgE from serum of sesame allergic patients - - - Western / Immunoblot 15536424 - Ses i 3 Ses i 3.0101 NPTDPEKQYQQCRLQCRRQGEG Sequential / Linear 125-147 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 3 Ses i 3 Ses i 3.0101 QLHEVDASQYRQLRD Sequential / Linear 410-424 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 3 Ses i 3 Ses i 3.0101 RRNVMNQLEREAKEL Sequential / Linear 536-550 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 3 Ses i 3 Ses i 3.0101 MPAREVEEVSRSQQEEFF Sequential / Linear 554-571 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 3 Ses i 3 Ses i 3.0101 PYVFEDQHFITGFRTQHGRMRVLQ Sequential / Linear 195-218 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 3 Ses i 3 Ses i 3.0101 DRSELLRGIENYRV Sequential / Linear 222-235 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 3 Ses i 3 Ses i 3.0101 FIVPNHWDAESVVFV Sequential / Linear 245-259 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 3 Ses i 3 Ses i 3.0101 INAGTTAYLINRDNNERL Sequential / Linear 287-304 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 3 Ses i 3 Ses i 3.0101 VLAKLLQPVSTPGEF Sequential / Linear 305-319 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 3 Ses i 3 Ses i 3.0101 ELFFGAGGENPE Sequential / Linear 320-331 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 3 Ses i 3 Ses i 3.0101 SFFKSFSDEILEAAFNTRRDRLQRIFG Sequential / Linear 332-358 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 3 Ses i 3 Ses i 3.0101 INIYQQRPTHSNQYG Sequential / Linear 395-409 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 3 Ses i 6 Ses i 6.0101 QTREPRLTQGQQCRFQRISGAQPSLRI Sequential / Linear 22-48 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 2 Ses i 6 Ses i 6.0101 ISPNQAQALKMNRGSQSFLLSPGGRRS Sequential / Linear 433-459 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 2 Ses i 6 Ses i 6.0101 QFQCAGIVAMRSTIRPNGLSLPNY Sequential / Linear 64-87 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 2 Ses i 6 Ses i 6.0101 GCAETYQVHRSQRTMERTEASEQQDRGSVRDLHQKVHRLRQG Sequential / Linear 109-150 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 2 Ses i 6 Ses i 6.0101 DVNHLSNQLDQKFRAFYLAGGVPRSGEQEQQARQTF Sequential / Linear 178-213 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 2 Ses i 6 Ses i 6.0101 GLIVMARERMTFVRP Sequential / Linear 247-261 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 2 Ses i 6 Ses i 6.0101 NGLEETFCTMKFRTN Sequential / Linear 277-291 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 2 Ses i 6 Ses i 6.0101 FSRQAGRVHVVDRNKLPILKYMDL Sequential / Linear 301-324 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 2 Ses i 6 Ses i 6.0101 PDWSMTGHTIVYVTRG Sequential / Linear 349-354 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 2 Ses i 6 Ses i 6.0101 GEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMP Sequential / Linear 375-423 - - IgE from serum of patients allergic to pistachio and cashew - - - SPOT assay DOI:10.3390/allergies1010006 Similar epitope to Pis v 2 Sta c 3 Sta c 3.0101 VKQMWPAESRKPMSG Sequential / Linear 91-105 - 165448 IgE from serum of S. chartarum allergic patient - - Immunodominant epitope Western / Immunoblot 22424314 Also an IgG-binding epitope Tri a 14 Tri a 14.0101 KNLHNQARSQ Sequential / Linear 55-64 1BWO  1CZ2  1GH1   117396 IgE from serum of patients with baker’s asthma - - - Western / Immunoblot 19846220 - Tri a 14 Tri a 14.0101 KGIARGIHNL Sequential / Linear 75-84 1BWO  1CZ2  1GH1   - IgE from serum of patients with baker’s asthma - - - Western / Immunoblot 19846220 - Tri a 14 Tri a 14.0101 RSIPPKCGVNLPYTI Sequential / Linear 90-104 1BWO  1CZ2  1GH1   - IgE from serum of patients with baker’s asthma - - - Western / Immunoblot 19846220 - Tri a 15 Tri a 15.0101 SWCDPATGYKVSALTGCRAMV Sequential / Linear 5-25 - 62430 IgE from serum of patients with baker's asthma - - - ELISA, RAST 2474614 - Tri a 19 Tri a 19.0101 QQIPQQQ Sequential / Linear 77-83 - 52043 IgE from serum of patients with WDEIA - - Immunodominant epitope ELISA and Western / Immunoblot 14699123 - Tri a 19 Tri a 19.0101 QQPPQQ Sequential / Linear 163-168 - 52097 IgE from serum of patients with WDEIA - - - ELISA 16128812 - Tri a 19 Tri a 19.0101 QQFHQQQ Sequential / Linear 336-342 - 52023 IgE from serum of patients with WDEIA - - - ELISA 16128812 - Tri a 19 Tri a 19.0101 QQFPQQQ Sequential / Linear 47-53 - 52028 IgE from serum of patients with WDEIA - - Immunodominant epitope ELISA and Western / Immunoblot 14699123 - Tri a 19 Tri a 19.0101 QQSPQQQ Sequential / Linear 268-274 - 52152 IgE from serum of patients with WDEIA - - Immunodominant epitope ELISA and Western / Immunoblot 14699123 - Tri a 19 Tri a 19.0101 QQSPEQQ Sequential / Linear 379-385 - 52151 IgE from serum of patients with WDEIA - - Immunodominant epitope ELISA and Western / Immunoblot 14699123 - Tri a 19 Tri a 19.0101 QQLPQQQ Sequential / Linear 139-145 - 52066 IgE from serum of patients with WDEIA - - - ELISA and Western / Immunoblot 14699123 - Tri a 19 Tri a 19.0101 QQYPQQQ Sequential / Linear 421-427 - 52180 IgE from serum of patients with WDEIA - - - ELISA and Western / Immunoblot 14699123 - Tri a 19 Tri a 19.0101 PYPP Sequential / Linear 408-411 - 50149 IgE from serum of patients with WDEIA - - - ELISA and Western / Immunoblot