Allergen |
Isoallergen / Variant |
Epitope |
Type of Epitope |
Sequence Position |
View on Structure |
IEDB |
Antibody Used |
IMGT |
AgAbDb Link |
Nature of Epitope |
Assay |
Reference |
Comment |
Alt a 1 | Alt a 1.0101 | KISEFYGRKP | Sequential / Linear | 41-50 | 3V0R 4AUD | 101790 | IgE from serum of patients with Alternaria-induced allergy | - | - | Major epitope | Western / Immunoblot | 12668200 | - |
Alt a 1 | Alt a 1.0101 | YYNSLGFNIK | Sequential / Linear | 54-63 | 3V0R 4AUD | 102271 | IgE from serum of patients with Alternaria-induced allergy | - | - | Major epitope | Western / Immunoblot | 12668200 | - |
Alt a 1 | Alt a 1.0101 | YSCGENSFMD | Sequential / Linear | 87-96 | 3V0R 4AUD | 102265 | IgE from serum of patients with Alternaria-induced allergy | - | - | - | Western / Immunoblot | 12668200 | - |
Alt a 1 | Alt a 1.0101 | VATATLPNYC | Sequential / Linear | 119-128 | 3V0R 4AUD | 102169 | IgE from serum of patients with Alternaria-induced allergy | - | - | - | Western / Immunoblot | 12668200 | - |
Amb a 11 | Amb a 11.0101 | GKLVKFSEQQLVDC | Sequential / Linear | 173-186 | 5EF4 5EGW | 1965359 | IgE from serum of ragweed allergic patients | - | - | - | ELISA | 35362839 | - |
Amb a 3 | Amb a 3.0101 | GKVYLVGGPELGGWK | Sequential / Linear | 1-15 | - | 20726 | IgE from serum of patients allergic to ragweed | - | - | Immunodominant epitope | Radio Immuno Assay | 2410296 | - |
Amb a 3 | Amb a 3.0101 | RAYALWSARQQFKTT | Sequential / Linear | 21-35 | - | 53247 | IgE from serum of patients allergic to ragweed | - | - | Immunodominant epitope | Radio Immuno Assay | 2410296 | - |
Amb a 3 | Amb a 3.0101 | QFKTTDVLWFNFTTG | Sequential / Linear | 31-45 | - | 50795 | IgE from serum of patients allergic to ragweed | - | - | Immunodominant epitope | Radio Immuno Assay | 2410296 | - |
Amb a 3 | Amb a 3.0101 | EVWREEAYHACDIKD | Sequential / Linear | 51-65 | - | 14906 | IgE from serum of patients allergic to ragweed | - | - | Immunodominant epitope | Radio Immuno Assay | 2410296 | - |
Amb a 3 | Amb a 3.0101 | PGGPDRFTLLTPGSH | Sequential / Linear | 71-85 | - | 47669 | IgE from serum of patients allergic to ragweed | - | - | - | Radio Immuno Assay | 2410296 | - |
Ana o 1 | Ana o 1.0101 | AIMGPPTKFSFSLFL | Sequential / Linear | | - | 2023 | IgE from serum of cashew allergic patients | - | - | Immunodominant epitope | Radio Immuno Assay | 12110836 | - |
Ana o 1 | Ana o 1.0101 | TKIAIVVSGEGCVEI | Sequential / Linear | 407-421 | - | 64582 | IgE from serum of cashew allergic patients | - | - | Weakly binding epitope | Radio Immuno Assay | 12110836 | - |
Ana o 1 | Ana o 1.0101 | SSHPSYKKLRARIRK | Sequential / Linear | 431-445 | - | 61072 | IgE from serum of cashew allergic patients | - | - | Weakly binding epitope | Radio Immuno Assay | 12110836 | - |
Ana o 1 | Ana o 1.0101 | KECEKYYKEKKGRER | Sequential / Linear | 55-69 | - | 30318 | IgE from serum of cashew allergic patients | - | - | Immunodominant epitope | Radio Immuno Assay | 12110836 | - |
Ana o 1 | Ana o 1.0101 | EEFFFQGPEWRKEKE | Sequential / Linear | 519-533 | - | 11615 | IgE from serum of cashew allergic patients | - | - | Immunodominant epitope | Radio Immuno Assay | 12110836 | - |
Ana o 1 | Ana o 1.0101 | CKVQRQYDEQQKEQC | Sequential / Linear | 39-53 | - | 6532 | IgE from serum of cashew allergic patients | - | - | Weakly binding epitope | Radio Immuno Assay | 12110836 | - |
Ana o 1 | Ana o 1.0101 | EQQKEQCVKECEKYY | Sequential / Linear | 47-61 | - | 13908 | IgE from serum of cashew allergic patients | - | - | Weakly binding epitope | Radio Immuno Assay | 12110836 | - |
Ana o 1 | Ana o 1.0101 | EKKGREREHEEEEEE | Sequential / Linear | 63-77 | - | 12729 | IgE from serum of cashew allergic patients | - | - | Moderately binding epitope | Radio Immuno Assay | 12110836 | - |
Ana o 1 | Ana o 1.0101 | DEAEEEDENPYVFED | Sequential / Linear | 143-157 | - | 7902 | IgE from serum of cashew allergic patients | - | - | Strongly binding epitope | Radio Immuno Assay | 12110836 | - |
Ana o 1 | Ana o 1.0101 | RRGEGPKIWPFTEES | Sequential / Linear | 335-349 | - | 55567 | IgE from serum of cashew allergic patients | - | - | Moderately binding epitope | Radio Immuno Assay | 12110836 | - |
Ana o 1 | Ana o 1.0101 | NITKGGMSVPFYNSR | Sequential / Linear | 391-405 | - | 44369 | IgE from serum of cashew allergic patients | - | - | Weakly binding epitope | Radio Immuno Assay | 12110836 | - |
Ana o 2 | Ana o 2.0101 | SRQEWQQQDECQIDR | Sequential / Linear | 15-29 | - | 137576 | IgE from pooled serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | QEWQQQDECQIDRLD | Sequential / Linear | 17-31 | - | 137555 | IgE from pooled serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | QGEGMTGISYPGCPE | Sequential / Linear | 89-103 | - | 137556 | IgE from pooled serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | QQGQSGRFQDRHQKI | Sequential / Linear | 113-127 | - | 137558 | IgE from pooled serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | QDRHQKIRRFRRGDI | Sequential / Linear | 121-135 | - | 137554 | IgE from pooled serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | AIPAGVAHWCYNEGN | Sequential / Linear | 137-151 | - | 137514 | IgE from pooled serum of cashew allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | LDRTPRKFHLAGNPK | Sequential / Linear | 169-183 | - | 137540 | IgE from pooled serum of cashew allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | RLIKQLKSEDNRGGI | Sequential / Linear | 217-231 | - | 137566 | IgE from pooled serum of cashew allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | LKWLQLSVEKGVLYK | Sequential / Linear | 313-327 | - | 137542 | IgE from pooled serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | ALVLPHWNLNSHSII | Sequential / Linear | 329-343 | - | 137516 | IgE from pooled serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | LNSHSIIYGCKGKGQ | Sequential / Linear | 337-351 | - | 137544 | IgE from pooled serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | YQAPQQGRQQGQSGR | Sequential / Linear | 105-119 | - | 137586 | IgE from pooled serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | QNFAVVKRAREERFE | Sequential / Linear | 377-391 | - | 137557 | IgE from pooled serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | AREERFEWISFKTND | Sequential / Linear | 385-399 | - | 137519 | IgE from pooled serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | PEEVLANAFQISRED | Sequential / Linear | 417-431 | - | 137551 | IgE from pooled serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | VFQQQQQHQSRGRNL | Sequential / Linear | 185-199 | - | 137579 | IgE from pooled serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | KVKDDELRVIRPSRS | Sequential / Linear | 233-247 | - | 137539 | IgE from pooled serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | VIRPSRSQSERGSES | Sequential / Linear | 241-255 | - | 137580 | IgE from pooled serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | EESEDEKRRWGQRDN | Sequential / Linear | 257-271 | - | 137395 | IgE from pooled serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | FQISREDARKIKFNN | Sequential / Linear | 425-439 | - | 137528 | IgE from pooled serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | LSVCFLILFHGCLAS | Sequential / Linear | 1-15 | - | 137546 | IgE from pooled serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 2 | Ana o 2.0101 | FHGCLASRQEWQQQD | Sequential / Linear | 9-23 | - | 137527 | IgE from pooled serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 14555856 | - |
Ana o 3 | Ana o 3.0101 | SGREQSCQRQFE | Sequential / Linear | 33-44 | - | 58215 | IgE from serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | RFRNCQRYVKQE | Sequential / Linear | 48-59 | - | 53773 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | YNQRQESLRECC | Sequential / Linear | 66-77 | - | 75208 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | RQESLRECCQEL | Sequential / Linear | 69-80 | - | 55412 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | ECCQELQEVDRR | Sequential / Linear | 75-86 | - | 11234 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | QELQEVDRRCRC | Sequential / Linear | 78-89 | - | 50648 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | IKGEEVRELYET | Sequential / Linear | 105-116 | - | 26794 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | ICSISPSQGCQF | Sequential / Linear | 123-134 | - | 25525 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | AFAVLLLVANASIYRAIVEVE | Sequential / Linear | 10-30 | - | - | IgE from cashew and tree-nut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 26769082 | - |
Ana o 3 | Ana o 3.0101 | RCRCQNLEQMVRQLQQQEQIKGE | Sequential / Linear | 85-108 | - | - | IgE from cashew and tree-nut allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 26769082 | - |
Ana o 3 | Ana o 3.0101 | CQRQFEEQQRFRNCQRYVKQEVQRGGRYNQRQE | Sequential / Linear | 39-71 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 1 |
Ana o 3 | Ana o 3.0101 | KQEVQRGGRYNQ | Sequential / Linear | 57-68 | - | 32975 | IgE from serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | SLRECCQELQEVDRRCR | Sequential / Linear | 72-88 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 1 |
Ana o 3 | Ana o 3.0101 | CQNLEQMVRQLQQQEQ | Sequential / Linear | 89-104 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 1 |
Ana o 3 | Ana o 3.0101 | YETASELPRICSISPSQG | Sequential / Linear | 114-131 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 1 |
Ana o 3 | Ana o 3.0101 | SLRECCQELQEV | Sequential / Linear | 72-83 | - | 59430 | IgE from serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | QEQIKGEEVREL | Sequential / Linear | 102-113 | - | 50677 | IgE from serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | CQRQFEEQQRFR | Sequential / Linear | 39-50 | - | 6897 | IgE from serum of cashew allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | RYVKQEVQRGGR | Sequential / Linear | 54-65 | - | 56675 | IgE from serum of cashew allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | LQQQEQIKGEEV | Sequential / Linear | 99-110 | - | 38962 | IgE from serum of cashew allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | QFEEQQRFRNCQ | Sequential / Linear | 42-53 | - | 50752 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | EQQRFRNCQRYV | Sequential / Linear | 45-56 | - | 13911 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ani s 1 | Ani s 1.0101 | ELFAREYEGVCKSGK | Sequential / Linear | 139-153 | - | 137145 | IgE from serum of Anisakis-allergic patients | - | - | Major epitope | Fluorescence ELISA | 20655337 | - |
Ani s 1 | Ani s 1.0101 | RGSGWMMTILGKSCD | Sequential / Linear | 159-173 | - | 137278 | IgE from serum of Anisakis-allergic patients | - | - | Major epitope | Fluorescence ELISA | 20655337 | - |
Ani s 5 | Ani s 5.0101 | LDAWVDTLGGDYKAKFETFK | Sequential / Linear | 58-77 | 2MAR | 230150 | Sera from Anisakis allergic patients | - | - | - | Microarray | 24603892 | - |
Ani s 5 | Ani s 5.0101 | AVAKMTPEAKKADAELSKIA | Sequential / Linear | 94-113 | 2MAR | 230107 | Sera from Anisakis allergic patients | - | - | - | Microarray | 24603892 | - |
Ani s 5 | Ani s 5.0101 | IQKAQKIQAIYKTLPQSVKD | Sequential / Linear | 121-140 | 2MAR | 230137 | Sera from Anisakis allergic patients | - | - | - | Microarray | 24603892 | - |
Ani s 7 | Ani s 7.0101 | MCQCVQKYGTEFCKKRLA | Sequential / Linear | 561-578 | - | 41204 | Epitope recognized by monoclonal antibody (mAb) UA3 and Anisakis sensitized patient IgE | - | - | Major epitope | ELISA and Antigen Competition | 18186812 | - |
Api m 10 | Api m 10.0101 | ADSDVTTLPTLIGKN | Sequential / Linear | 179-193 | - | - | Serum from Api m 10 sensitive patients | - | - | Immunodominant epitope | ImmunoCAP Test | 31957885 | - |
Ara h 1 | Ara h 1.0101 | AKSSPYQKKT | Sequential / Linear | 25-34 | - | 2286 | IgE from serum of peanut allergic patients | - | - | Immunodominant epitope | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | TPGQFEDFFP | Sequential / Linear | 294-303 | 3SMH 3S7I 3S7E | 99029 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | SYLQGFSRNT | Sequential / Linear | 311-320 | 3SMH 3S7I 3S7E | 99017 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | FNAEFNEIRR | Sequential / Linear | 325-334 | 3SMH 3S7I 3S7E | 98775 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | EQEERGQRRW | Sequential / Linear | 344-353 | - | 98767 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | DITNPINLRE | Sequential / Linear | 393-402 | 3SMH 3S7I 3S7E | 98731 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | NNFGKLFEVK | Sequential / Linear | 409-418 | 3SMH 3S7I 3S7E | 98915 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | GTGNLELVAV | Sequential / Linear | 461-470 | 3SMH 3S7I 3S7E | 98808 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | RRYTARLKEG | Sequential / Linear | 498-507 | 3SMH 3S7I 3S7E | 55787 | IgE from serum of peanut allergic patients | - | - | Immunodominant epitope | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | ELHLLGFGIN | Sequential / Linear | 525-534 | 3SMH 3S7I 3S7E | 98758 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | HRIFLAGDKD | Sequential / Linear | 539-548 | 3SMH 3S7I 3S7E | 98815 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | QEPDDLKQKA | Sequential / Linear | 48-57 | - | 98953 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | IDQIEKQAKD | Sequential / Linear | 551-560 | 3SMH 3S7I 3S7E | 98821 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | KDLAFPGSGE | Sequential / Linear | 559-568 | 3SMH 3S7I 3S7E | 98842 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | KESHFVSARP | Sequential / Linear | 578-587 | - | 98844 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | PEKESPEKED | Sequential / Linear | 597-606 | - | 98927 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | SATHAKSSPYQKKT | Sequential / Linear | 21-34 | - | - | IgE from serum of patients with peanut hypersensitivity | - | - | Immunodominant epitope | ELISA | DOI:10.1080/09540100802172599 | - |
Ara h 1 | Ara h 1.0101 | GERTRGRQPG | Sequential / Linear | 89-98 | - | - | IgE from serum of patients with peanut hypersensitivity | - | - | Immunodominant epitope | ELISA | DOI:10.1080/09540100802172599 | - |
Ara h 1 | Ara h 1.0101 | DITNPINLREG | Sequential / Linear | 393-403 | 3SMH 3S7I 3S7E | - | IgE from serum of patients with peanut hypersensitivity | - | - | Immunodominant epitope | ELISA | DOI:10.1080/09540100802172599 | - |
Ara h 1 | Ara h 1.0101 | RRYTARLKEG | Sequential / Linear | 498-507 | 3SMH 3S7I 3S7E | - | IgE from serum of patients with peanut hypersensitivity | - | - | Immunodominant epitope | ELISA | DOI:10.1080/09540100802172599 | - |
Ara h 1 | Ara h 1.0101 | KESPEKEDQEEE | Sequential / Linear | 598-610 | - | - | IgE from serum of patients with peanut hypersensitivity | - | - | Immunodominant epitope | ELISA | DOI:10.1080/09540100802172599 | - |
Ara h 1 | Ara h 1.0101 | LEYDPRCVYD | Sequential / Linear | 65-74 | - | 98871 | IgE from serum of peanut allergic patients | - | - | Immunodominant epitope | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | GERTRGRQPG | Sequential / Linear | 89-98 | - | 98795 | IgE from serum of peanut allergic patients | - | - | Immunodominant epitope | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | PGDYDDDRRQ | Sequential / Linear | 97-105 | - | 98931 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | PRREEGGRWG | Sequential / Linear | 107-116 | - | 98942 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | REREEDWRQP | Sequential / Linear | 123-132 | - | 98981 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | EDWRRPSHQQ | Sequential / Linear | 134-143 | - | 98746 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 1 | Ara h 1.0101 | QPRKIRPEGR | Sequential / Linear | 143-152 | - | 98966 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9151961 | - |
Ara h 15 | Ara h 15.0101 | DKARDVKDRAKDYAG | Sequential / Linear | 151-155 | - | 165448 | IgE from serum of Peanut-allergic patient | - | - | Strongly binding epitope | Microarray | 28342912 | - |
Ara h 15 | Ara h 15.0101 | SDQTRTGY | Sequential / Linear | 2-9 | - | 169691 | IgE from Peanut-allergic patients | - | - | - | ELISA,MS | 22790944 | Buckwheat cross-reactive epitope |
Ara h 2 | Ara h 2.0101 | HASARQQWEL | Sequential / Linear | 18-27 | - | 23562 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9186485 | - |
Ara h 2 | Ara h 2.0101 | QRCDLDVE | Sequential / Linear | 146-153 | - | 52191 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9186485 | - |
Ara h 2 | Ara h 2.0101 | RDPYSPSQDPYSPS | Sequential / Linear | 62-75 | - | 157833 | IgE from Peanut-allergic patients | - | - | - | Western / Immunoblot | 21883278 | - |
Ara h 2 | Ara h 2.0101 | QWELQGDR | Sequential / Linear | 24-31 | - | 52829 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9186485 | - |
Ara h 2 | Ara h 2.0101 | DRRCQSQLER | Sequential / Linear | 30-39 | - | 10040 | IgE from serum of peanut allergic patients | - | - | Immunodominant epitope | Western / Immunoblot | 9186485 | - |
Ara h 2 | Ara h 2.0101 | LRPCEQHLMQ | Sequential / Linear | 42-51 | - | 39156 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9186485 | - |
Ara h 2 | Ara h 2.0101 | KIQRDEDS | Sequential / Linear | 52-59 | - | 31404 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9186485 | - |
Ara h 2 | Ara h 2.0101 | RDPYSP | Sequential / Linear | 62-67 | - | 73754 | IgE from serum of peanut allergic patients | - | - | Immunodominant epitope | Western / Immunoblot | 9186485 | - |
Ara h 2 | Ara h 2.0101 | SQDPYSPS | Sequential / Linear | 68-75 | - | 60413 | IgE from serum of peanut allergic patients | - | - | Immunodominant epitope | Western / Immunoblot | 9186485 | - |
Ara h 2 | Ara h 2.0101 | LQGRQQ | Sequential / Linear | 120-125 | - | 10012 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9186485 | - |
Ara h 2 | Ara h 2.0101 | KRELRN | Sequential / Linear | 130-135 | - | 33122 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 9186485 | - |
Ara h 3 | Ara h 3.0101 | IETWNPNNQEFECAG | Sequential / Linear | 30-44 | 3C3V | 25997 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 10021462 | - |
Ara h 3 | Ara h 3.0101 | RQQDRRRGRGSR | Sequential / Linear | 336-350 | - | 106086 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 18995911 | GenBank Protein: AAM46958.1 |
Ara h 3 | Ara h 3.0101 | ICTASFKKNIGRNRSPDIYNP | Sequential / Linear | 357-371 | - | 105872 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 18995911 | GenBank Protein: AAM46958.1 |
Ara h 3 | Ara h 3.0101 | PREQARQLKNNNPFKFFVPPSEQS | Sequential / Linear | 510-533 | - | 106008 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 18995911 | GenBank Protein: AAM46958.1 |
Ara h 3 | Ara h 3.0101 | YEYDEEDRRR | Sequential / Linear | 304-313 | - | 693201 | mAbs P1 and P2 | - | - | - | SPOT assay, ELISA | 28800361 | - |
Ara h 3 | Ara h 3.0101 | GNIFSGFTPEFLEQA | Sequential / Linear | 237-251 | - | 21443 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 10021462 | - |
Ara h 3 | Ara h 3.0101 | VTVRGGLRILSPDRK | Sequential / Linear | 276-290 | 3C3V | 71559 | IgE from serum of peanut allergic patients | - | - | Immunodominant epitope | Western / Immunoblot | 10021462 | - |
Ara h 3 | Ara h 3.0101 | DEDEYEYDEEDRRRG | Sequential / Linear | 300-314 | 3C3V | 7932 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 10021462 | - |
Ara h 3 | Ara h 3.0101 | ALSRLVLRRNALRRP | Sequential / Linear | 46-60 | 3C3V | 2894 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 18995911 | GenBank Protein: AAM46958.1 |
Ara h 3 | Ara h 3.0101 | EPAQQGRRHQSQRPP | Sequential / Linear | 114-128 | 3C3V | 105757 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 18995911 | GenBank Protein: AAM46958.1 |
Ara h 3 | Ara h 3.0101 | LRYQQQSRRRSLPYS | Sequential / Linear | 207-221 | - | 105940 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 18995911 | GenBank Protein: AAM46958.1 |
Ara h 3 | Ara h 3.0101 | REFSPRGQHGRR | Sequential / Linear | 234-248 | - | 106057 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 18995911 | GenBank Protein: AAM46958.1 |
Ara h 3 | Ara h 3.0101 | GGLRILSPDRKR | Sequential / Linear | 300-311 | 3C3V | 105826 | IgE from serum of peanut allergic patients | - | - | - | Western / Immunoblot | 18995911 | GenBank Protein: AAM46958.1 |
Ara h 6 | Ara h 6.0101 | DRQMVQHFKR | Sequential / Linear | 110-119 | - | 157172 | IgE from Peanut-allergic patients | - | - | - | Western / Immunoblot | 21883278 | - |
Ara h 7 | Ara h 7.0101 | DDQCQRQLQR | Sequential / Linear | 42-51 | - | 157158 | IgE from Peanut-allergic patients | - | - | - | Western / Immunoblot | 21883278 | - |
Ara h 7 | Ara h 7.0101 | EQRCCNELNR | Sequential / Linear | 96-105 | - | 157219 | IgE from Peanut-allergic patients | - | - | - | Western / Immunoblot | 21883278 | - |
Ara h 9 | Ara h 9.0101 | LAPCIPFLTKGGAPPPACCS | Sequential / Linear | 34-53 | - | 2141111 | IgE from serum of peach allergic patients | - | - | - | Microarray | 35935018 | - |
Ara h 9 | Ara h 9.0101 | TTADRQAACNCLKAAAGSLR | Sequential / Linear | 64-83 | - | 2143898 | IgE from serum of peach allergic patients | - | - | - | Microarray | 35935018 | - |
Ara h 9 | Ara h 9.0101 | LNQGNAAALPGRCGVSIPYK | Sequential / Linear | 85-104 | - | 1861901 | IgE from serum of peach allergic patients | - | - | - | Microarray | 35935018 | - |
Ara h 9 | Ara h 9.0101 | CGVSIPYKISTSTNCATIKF | Sequential / Linear | 97-116 | - | 2139083 | IgE from serum of peach allergic patients | - | - | - | Microarray | 35935018 | - |
Ara h PNA | - | NIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVA | Sequential / Linear | 54-86 | 1BZW 1CIW 1CQ9 1CR7 1QF3 1RIR 1RIT 1V6I 1V6J 1V6K 1V6L 1V6M 1V6N 1V6O 2DH1 2DV9 2DVA 2DVB 2DVD 2DVF 2DVG 2PEL 2TEP | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Ara h PNA | - | LGVSDTKGA | Sequential / Linear | 129-137 | 1BZW 1CIW 1CQ9 1CR7 1QF3 1RIR 1RIT 1V6I 1V6J 1V6K 1V6L 1V6M 1V6N 1V6O 2DH1 2DV9 2DVA 2DVB 2DVD 2DVF 2DVG 2PEL 2TEP | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Ara h PNA | - | VDSVKTVPWNSVSGA | Sequential / Linear | 168-182 | 1BZW 1CIW 1CQ9 1CR7 1QF3 1RIR 1RIT 1V6I 1V6J 1V6K 1V6L 1V6M 1V6N 1V6O 2DH1 2DV9 2DVA 2DVB 2DVD 2DVF 2DVG 2PEL 2TEP | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Ara h PNA | - | IYDSSTKTL | Sequential / Linear | 189-197 | 1BZW 1CIW 1CQ9 1CR7 1QF3 1RIR 1RIT 1V6I 1V6J 1V6K 1V6L 1V6M 1V6N 1V6O 2DH1 2DV9 2DVA 2DVB 2DVD 2DVF 2DVG 2PEL 2TEP | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Ara h PNA | - | QVVDLKAKLPERVKF | Sequential / Linear | 213-227 | 1BZW 1CIW 1CQ9 1CR7 1QF3 1RIR 1RIT 1V6I 1V6J 1V6K 1V6L 1V6M 1V6N 1V6O 2DH1 2DV9 2DVA 2DVB 2DVD 2DVF 2DVG 2PEL 2TEP | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Ara h PNA | - | ASGSLGGRQIHLIRSWSFTSTLITT | Sequential / Linear | 231-255 | 1BZW 1CIW 1CQ9 1CR7 1QF3 1RIR 1RIT 1V6I 1V6J 1V6K 1V6L 1V6M 1V6N 1V6O 2DH1 2DV9 2DVA 2DVB 2DVD 2DVF 2DVG 2PEL 2TEP | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Asp f 1 | Asp f 1.0101 | WTCINQQLNP | Sequential / Linear | 30-39 | - | - | IgE from serum of allergic bronchopulmonary aspergillosis patients | - | - | - | ELISA | 9864052 | - |
Asp f 1 | Asp f 1.0101 | PGPARVIYTY | Sequential / Linear | 143-152 | - | 47719 | IgE from serum of allergic bronchopulmonary aspergillosis patients | - | - | Immunodominant epitope | ELISA | 9864052 | - |
Asp f 1 | Asp f 1.0101 | VIYTYPNKVF | Sequential / Linear | 148-157 | - | 69172 | IgE from serum of allergic bronchopulmonary aspergillosis patients | - | - | Immunodominant epitope | ELISA | 9864052 | - |
Asp f 1 | Asp f 1.0101 | GIVAHQRGNQ | Sequential / Linear | 159-168 | - | 20469 | IgE from serum of allergic bronchopulmonary aspergillosis patients | - | - | - | ELISA | 9864052 | - |
Asp f 1 | Asp f 1.0101 | NQGDLRLCSH | Sequential / Linear | 167-176 | - | 45557 | IgE from serum of allergic bronchopulmonary aspergillosis patients | - | - | Immunodominant epitope | ELISA | 9864052 | - |
Asp f 1 | Asp f 1.0101 | KTNKWEDKRL | Sequential / Linear | 40-49 | - | - | IgE from serum of allergic bronchopulmonary aspergillosis patients | - | - | - | ELISA | 9864052 | - |
Asp f 1 | Asp f 1.0101 | YNQAKAESNS | Sequential / Linear | 51-60 | - | - | IgE from serum of allergic bronchopulmonary aspergillosis patients | - | - | - | ELISA | 9864052 | - |
Asp f 1 | Asp f 1.0101 | DGKTGSSTPH | Sequential / Linear | 67-76 | - | - | IgE from serum of allergic bronchopulmonary aspergillosis patients | - | - | - | ELISA | 9864052 | - |
Asp f 1 | Asp f 1.0101 | WFTNGYDGNG | Sequential / Linear | 77-86 | - | - | IgE from serum of allergic bronchopulmonary aspergillosis patients | - | - | - | ELISA | 9864052 | - |
Asp f 1 | Asp f 1.0101 | GRTPIKFGKA | Sequential / Linear | 91-100 | - | - | IgE from serum of allergic bronchopulmonary aspergillosis patients | - | - | - | ELISA | 9864052 | - |
Asp f 1 | Asp f 1.0101 | CDRPPKHSQN | Sequential / Linear | 102-111 | - | - | IgE from serum of allergic bronchopulmonary aspergillosis patients | - | - | - | ELISA | 9864052 | - |
Asp f 1 | Asp f 1.0101 | GKDDHYLLEF | Sequential / Linear | 114-123 | - | 20526 | IgE from serum of allergic bronchopulmonary aspergillosis patients | - | - | - | ELISA | 9864052 | - |
Asp f 1 | Asp f 1.0101 | FPTFPDGHDY | Sequential / Linear | 123-132 | - | 17418 | IgE from serum of allergic bronchopulmonary aspergillosis patients | - | - | - | ELISA | 9864052 | - |
Asp f 13 | Asp f 13.0101 | NSDASNTSPASAPNALTVAAINKSNARASFSNYGSVVD | Sequential / Linear | 286-323 | - | 45775 | IgE from serum of patients allergic to A. fumigatus | - | - | Immunodominant epitope | Dot-blot, N-terminal sequencing and mass spectrometry | 10677362 | - |
Asp f 13 | Asp f 13.0101 | IFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSVYLMGLENLSGPAAVTARIKE | Sequential / Linear | 324-380 | - | - | IgE from serum of patients allergic to A. fumigatus | - | - | Immunodominant epitope | Dot-blot, N-terminal sequencing and mass spectrometry | 10677362 | - |
Asp f 13 | Asp f 13.0101 | GLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNGNA | Sequential / Linear | 364-403 | - | 20819 | IgE from serum of patients allergic to A. fumigatus | - | - | Immunodominant epitope | Dot-blot, N-terminal sequencing and mass spectrometry | 10677362 | - |
Asp f 2 | Asp f 2.0101 | ATQRRQI | Sequential / Linear | 58-64 | - | 106669 | IgE from pooled serum of allergic aspergillosis patients | - | - | Immunodominant epitope | Western / Immunoblot | 10225885 | - |
Asp f 2 | Asp f 2.0101 | RKYFG | Sequential / Linear | 93-97 | - | 106780 | IgE from pooled serum of allergic aspergillosis patients | - | - | Immunodominant epitope | Western / Immunoblot | 10225885 | - |
Asp f 2 | Asp f 2.0101 | HWR | Sequential / Linear | 138-140 | - | 106524 | IgE from pooled serum of allergic aspergillosis patients | - | - | Immunodominant epitope | Western / Immunoblot | 10225885 | - |
Asp f 2 | Asp f 2.0101 | YTTRR | Sequential / Linear | 155-159 | - | 107034 | IgE from pooled serum of allergic aspergillosis patients | - | - | Immunodominant epitope | Western / Immunoblot | 10225885 | - |
Asp f 2 | Asp f 2.0101 | ASDLM | Sequential / Linear | 181-185 | - | 106270 | IgE from pooled serum of allergic aspergillosis patients | - | - | Immunodominant epitope | Western / Immunoblot | 10225885 | - |
Asp f 2 | Asp f 2.0101 | YHVP | Sequential / Linear | 189-192 | - | 107016 | IgE from pooled serum of allergic aspergillosis patients | - | - | Immunodominant epitope | Western / Immunoblot | 10225885 | - |
Asp f 2 | Asp f 2.0101 | DHFAD | Sequential / Linear | 200-204 | - | 106336 | IgE from pooled serum of allergic aspergillosis patients | - | - | Immunodominant epitope | Western / Immunoblot | 10225885 | - |
Asp f 2 | Asp f 2.0101 | ALEAYA | Sequential / Linear | 231-236 | - | 106248 | IgE from pooled serum of allergic aspergillosis patients | - | - | Immunodominant epitope | Western / Immunoblot | 10225885 | - |
Asp f 2 | Asp f 2.0101 | THEGGQ | Sequential / Linear | 301-306 | - | 106904 | IgE from pooled serum of allergic aspergillosis patients | - | - | Immunodominant epitope | Western / Immunoblot | 10225885 | - |
Asp f 3 | Asp f 3.0101 | VFSYIPWSEDK | Sequential / Linear | 15-25 | - | - | IgE from serum of patients with allergic bronchopulmonary aspergillosis | - | - | - | ELISA | 12173308 | - |
Asp f 3 | Asp f 3.0101 | ACGIPINYNASKEWADKKVIL | Sequential / Linear | 30-50 | - | - | IgE from serum of patients with allergic bronchopulmonary aspergillosis | - | - | - | ELISA | 12173308 | - |
Asp f 3 | Asp f 3.0101 | VCSARHVPEYI | Sequential / Linear | 60-70 | - | - | IgE from serum of patients with allergic bronchopulmonary aspergillosis | - | - | - | ELISA | 12173308 | - |
Asp f 3 | Asp f 3.0101 | AVLAYNDAYVMSAWGK | Sequential / Linear | 85-100 | - | - | IgE from serum of patients with allergic bronchopulmonary aspergillosis | - | - | - | ELISA | 12173308 | - |
Asp f 3 | Asp f 3.0101 | PDARFSKSIGW | Sequential / Linear | 115-125 | - | - | IgE from serum of patients with allergic bronchopulmonary aspergillosis | - | - | - | ELISA | 12173308 | - |
Asp f 3 | Asp f 3.0101 | GRTKRYALVIDHGKIT | Sequential / Linear | 130-145 | - | - | IgE from serum of patients with allergic bronchopulmonary aspergillosis | - | - | - | ELISA | 12173308 | - |
Asp f 3 | Asp f 3.0101 | EPAKNHLEFSSAETVL | Sequential / Linear | 150-165 | - | - | IgE from serum of patients with allergic bronchopulmonary aspergillosis | - | - | - | ELISA | 12173308 | - |
Asp t 36 | Asp t 36.0101 | IGVAAQNVFDKPNGAFTGEIS | Sequential / Linear | 58-78 | - | - | Pooled sera from A. terreus sensitive patients | - | - | Immunodominant epitope | ELISA | 33082142 | - |
Asp t 36 | Asp t 36.0101 | DWTLIGHSERRVILKESDEFIARKVK | Sequential / Linear | 88-113 | - | - | Pooled sera from A. terreus sensitive patients | - | - | Immunodominant epitope | ELISA | 33082142 | - |
Asp t 36 | Asp t 36.0101 | AIGTGKVATTEQAQEVHAA | Sequential / Linear | 170-188 | - | - | Pooled sera from A. terreus sensitive patients | - | - | Immunodominant epitope | ELISA | 33082142 | - |
Asp t 36 | Asp t 36.0101 | AKQPDVDGFLVGGASLKP | Sequential / Linear | 222-239 | - | - | Pooled sera from A. terreus sensitive patients | - | - | Immunodominant epitope | ELISA | 33082142 | - |
Asp v 13 | Asp v 13.0101 | ALLPAVFGAPILEARRQTEKVPGK | Sequential / Linear | 13-36 | - | - | IgE from serum of patients allergic to fungi | - | - | - | Western / Immunoblot | 21632114 | - |
Asp v 13 | Asp v 13.0101 | TTWASNVHKRNLERRDLTD | Sequential / Linear | 54-72 | - | - | IgE from serum of patients allergic to fungi | - | - | - | Western / Immunoblot | 21632114 | - |
Asp v 13 | Asp v 13.0101 | IEKNFKIHKFAA | Sequential / Linear | 79-90 | - | - | IgE from serum of patients allergic to fungi | - | - | - | Western / Immunoblot | 21632114 | - |
Asp v 13 | Asp v 13.0101 | GTIGGKTFGVSKKANLLS | Sequential / Linear | 199-216 | - | - | IgE from serum of patients allergic to fungi | - | - | - | Western / Immunoblot | 21632114 | - |
Asp v 13 | Asp v 13.0101 | NWAANDIVSKSRTGKSAI | Sequential / Linear | 235-253 | - | - | IgE from serum of patients allergic to fungi | - | - | - | Western / Immunoblot | 21632114 | - |
Asp v 13 | Asp v 13.0101 | LTVAASTERNAR | Sequential / Linear | 301-312 | - | - | IgE from serum of patients allergic to fungi | - | - | - | Western / Immunoblot | 21632114 | - |
Ber e 1 | Ber e 1.0101 | QMQRQQMLSHCRMY | Sequential / Linear | 43-56 | 2LVF | 51634 | IgE from serum of Brazil nut allergic patient | - | - | - | ELISA | 15465060 | - |
Bet v 1 | Bet v 1.0101 | GDNLFPKVAPQAIS | Sequential / Linear | 27-40 | 1B6F 1BTV 1BV1 1FSK 1LLT 1QMR 4A80 4A81 4A83 4A84 4A85 4A86 4A87 4A88 4A8G 4B9R 4BK6 4BK7 4BKC 4BKD 4BTZ 4MNS 4QIP 4Z3L
| 196944 | Recombinant human IgE from a combinatorial antibody fragment library | - | - | - | ELISA and Antigen Competition | 24447087 | - |
Bet v 1 | Bet v 1.0101 | ISFPEGFPFKYVKD | Sequential / Linear | 57-70 | 1B6F 1BTV 1BV1 1FSK 1LLT 1QMR 4A80 4A81 4A83 4A84 4A85 4A86 4A87 4A88 4A8G 4B9R 4BK6 4BK7 4BKC 4BKD 4BTZ 4MNS 4QIP 4Z3L
| 196955 | Recombinant human IgE from a combinatorial antibody fragment library | - | - | - | ELISA and Antigen Competition | 24447087 | - |
Bet v 1 | Bet v 1.0101 | ILDGDNLFPKVAPQAI | Sequential / Linear | 24-39 | 1B6F 1BTV 1BV1 1FSK 1LLT 1QMR 4A80 4A81 4A83 4A84 4A85 4A86 4A87 4A88 4A8G 4B9R 4BK6 4BK7 4BKC 4BKD 4BTZ 4MNS 4QIP 4Z3L
| 26996 | IgE from birch pollen-allergic patients | - | - | - | Antigen Competition,Hypersensitivity and Prausnitz-Kustner inhibition | 7684629 | Part of Haptenic epitope |
Bet v 1 | Bet v 1.0101 | EQVKASKEMGETLLRAVESYLLA | Sequential / Linear | 132-154 | 1B6F 1BTV 1BV1 1FSK 1LLT 1QMR 4A80 4A81 4A83 4A84 4A85 4A86 4A87 4A88 4A8G 4B9R 4BK6 4BK7 4BKC 4BKD 4BTZ 4MNS 4QIP 4Z3L
| 176804 | Anti-Bet v 1 IgE from phage-display scFv hybrid library | - | - | - | ELISA and Immunoblot | 23066955 | E149 is critical for Ab-binding |
Bet v 1 | Bet v 1.0101 | DGDNLFPKVA | Sequential / Linear | 26-35 | 1B6F 1BTV 1BV1 1FSK 1LLT 1QMR 4A80 4A81 4A83 4A84 4A85 4A86 4A87 4A88 4A8G 4B9R 4BK6 4BK7 4BKC 4BKD 4BTZ 4MNS 4QIP 4Z3L
| 8363 | IgE from pollen allergic patients | - | - | - | Competitive binding | 2477335 | - |
Bet v 1 | Bet v 1.0101 | ISFPEGFPFKYVK | Sequential / Linear | 57-69 | 1B6F 1BTV 4A80 4A81 4A83 4A84 4A85 4A86 4A87 4A88 4A8G 4B9R 4BK6 4BK7 4BKC 4BKD 4BTZ 4MNS 4QIP 4Z3L | 767238 | Monoclonal antibody 5B4 | - | - | - | Pepscan, Hydrogen / Deuterium exchange-MS | 29171882 | P59,E60,G61,F62,F64,K65 are critical for serum IgE binding |
Bet v 2 | Bet v 2.0101 | MSWQTYVDEHLMCDIDGQGEELAASAIVGHDG | Sequential / Linear | 1-32 | - | 78467 | IgE from serum of profilin-allergic patients | - | - | Major epitope | Phage display / Immunopanning | 9016715 | - |
Bet v 2 | Bet v 2.0101 | VGHDGSVWAQSSSFPQFKPQ | Sequential / Linear | 28-47 | 1CQA | 78553 | IgE from serum of profilin-allergic patients | - | - | Major epitope | Phage display / Immunopanning | 9016715 | - |
Bet v 2 | Bet v 2.0101 | VWAQSSSFPQFKPQE | Sequential / Linear | 34-48 | 1CQA | 78561 | IgE from serum of profilin-allergic patients | - | - | Major epitope | Phage display / Immunopanning | 9016715 | - |
Bet v 2 | Bet v 2.0101 | AQSSSFPQFKPQEITGI | Sequential / Linear | 36-52 | 1CQA | 78351 | IgE from serum of profilin-allergic patients | - | - | Major epitope | Phage display / Immunopanning | 9016715 | - |
Bet v 2 | Bet v 2.0101 | IYEEPVTPGQCNMVVERLGDYLIDQGL | Sequential / Linear | 107-133 | 1CQA | 78427 | IgE from serum of profilin-allergic patients | - | - | Major epitope | Phage display / Immunopanning | 9016715 | - |
Bet v 2 | Bet v 2.0101 | PQFKPQ | Sequential / Linear | 42-47 | 1CQA | 48996 | Monoclonal antibody 4A6 | IMGT/3Dstructure-DB | - | - | Western blot | 8939935 | Monoclonal antibody from Mouse |
Bla g 4 | Bla g 4.0101 | CPAAANGHVIYVQLRLTWRRFHPKLGDKEMIQHYT | Sequential / Linear | 118-152 | - | 104526 | IgE from serum of cockroach-allergic patients | - | - | Major epitope | ELISA | 19290089 | - |
Bla g 5 | Bla g 5.0101 | EDYRFQEGDWPNLKP | Sequential / Linear | 31-45 | 4Q5R | 174085 | IgE from serum of filarial-infected patients allergic to cockroach allergen Bla g 5.0101 | - | - | - | Western / Immunoblot and Antigen Competition | 22541242 | - |
Bla g 5 | Bla g 5.0101 | EIDGKQTHQSVAISRYLGKQ | Sequential / Linear | 56-75 | 4Q5R | 174094 | IgE from serum of filarial-infected patients allergic to cockroach allergen Bla g 5.0101 | - | - | - | Western / Immunoblot and Antigen Competition | 22541242 | - |
Bla g 5 | Bla g 5.0101 | YHYDADENSKQKKWDPLKKE | Sequential / Linear | 106-125 | 4Q5R | 174324 | IgE from serum of filarial-infected patients allergic to cockroach allergen Bla g 5.0101 | - | - | - | Western / Immunoblot and Antigen Competition | 22541242 | - |
Bla g 5 | Bla g 5.0101 | TKKFDEVVKANGGYLAAGKLTWADF | Sequential / Linear | 131-155 | 4Q5R | 174296 | IgE from serum of filarial-infected patients allergic to cockroach allergen Bla g 5.0101 | - | - | - | Western / Immunoblot and Antigen Competition | 22541242 | - |
Blo t 12 | Blo t 12.0101 | HTEPDDHHEKPTTQCTHEET | Sequential / Linear | 30-49 | - | - | IgE from serum of asthmatic patients allergic to B. tropicalis | - | - | - | Inhibition ELISA | 19226278 | - |
Blo t 12 | Blo t 12.0101 | TEETHHSDDLIVHEGGKTYH | Sequential / Linear | 73-92 | - | - | IgE from serum of asthmatic patients allergic to B. tropicalis | - | - | - | Inhibition ELISA | 19226278 | - |
Blo t 12 | Blo t 12.0101 | IICSKSGSLWYITVMPCSIG | Sequential / Linear | 111-130 | 2MFK | - | IgE from serum of asthmatic patients allergic to B. tropicalis | - | - | - | Inhibition ELISA | 19226278 | - |
Blo t 13 | Blo t 13.0101 | STFKNTEIKFKLGEEFEED | Sequential / Linear | 54-72 | - | 956712 | Sera from patients with allergy to HDM and sensitized to Blo t 13 | - | - | - | ELISA | 31817065 | - |
Blo t 13 | Blo t 13.0101 | DVVVTASVGDVTSVRTYKR | Sequential / Linear | 111-129 | - | 956534 | Sera from patients with allergy to HDM and sensitized to Blo t 13 | - | - | - | ELISA | 31817065 | - |
Blo t 5 | Blo t 5.0101 | ELKRTDLNILERFNYE | Sequential / Linear | 93-108 | 2JMH 2JRK 2MEY | 97456 | IgE from serum of patients allergic to B.tropicalis extract | - | - | Major epitope | ELISA | 18684949 | - |
Bomb m 4 | Bomb m 4.0101 | QFRVIFTEQTVKLIN | Sequential / Linear | 99-113 | - | - | Sera of patients allergic to Silkworm pupa | - | - | - | ELISA | 35028994 | - |
Bomb m 4 | Bomb m 4.0101 | MFFVYNREYNSVMTL | Sequential / Linear | 209-223 | - | - | Sera of patients allergic to Silkworm pupa | - | - | - | ELISA | 35028994 | - |
Bomb m 4 | Bomb m 4.0101 | VSGYPQLFAWYIVPY | Sequential / Linear | 242-256 | - | - | Sera of patients allergic to Silkworm pupa | - | - | - | ELISA | 35028994 | - |
Bos d 10 | Bos d 10.0101 | YQKFALPQYL | Sequential / Linear | 186-195 | - | 75506 | IgE from serum of patients with persistent cow's milk allergy | - | - | - | Western / Immunoblot | 12170271 | - |
Bos d 10 | Bos d 10.0101 | VVRNANEEEYSIGS | Sequential / Linear | 58-71 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Minor epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | PQYLQYLYQGPIVL | Sequential / Linear | 108-121 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Minor epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | VLNPWDQVKR | Sequential / Linear | 120-129 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Minor epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | VPITPTLNREQL | Sequential / Linear | 132-143 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Minor epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | KPWIQPKTKV | Sequential / Linear | 206-215 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Minor epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | NMAINPSK | Sequential / Linear | 40-47 | - | - | Serum of cow milk-allergic patients | - | - | - | Dot blot | 36307246 | - |
Bos d 10 | Bos d 10.0101 | KNTMEHVSSSEESIISQETYKQEKNMAINPSK | Sequential / Linear | 16-47 | - | 78187 | IgE from serum of patients with cow's milk allergy | - | - | - | Microarray | 18774394 | - |
Bos d 10 | Bos d 10.0101 | EEVKITVDDKHYQKALNEIN | Sequential / Linear | 82-101 | - | 78138 | IgE from serum of patients with cow's milk allergy | - | - | - | Microarray | 18774394 | - |
Bos d 10 | Bos d 10.0101 | KTVYQHQKAMKPWIQPKTKVIPYVRYL | Sequential / Linear | 196-222 | - | 78189 | IgE from serum of patients with cow's milk allergy | - | - | - | Microarray | 18774394 | - |
Bos d 10 | Bos d 10.0101 | NEINQFYQKFPQYLQYLY | Sequential / Linear | 98-115 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Major epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | STEVFTKKTKLTEEEK | Sequential / Linear | 158-173 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Major epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | EKNRLNFLKKISQRYQ | Sequential / Linear | 172-187 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Major epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | KKISQRYQKFALPQYLKTVYQHQK | Sequential / Linear | 180-203 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Major epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | SKENLCSTFCKEVV | Sequential / Linear | 46-59 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Minor epitope | Western / Immunoblot | 12373003 | - |
Bos d 11 | Bos d 11.0101 | INKKIEKFQSEEQQQTEDELQDKIH | Sequential / Linear | 41-65 | - | 78259 | IgE from serum of patients with cow's milk allergy | - | - | - | Microarray | 18774394 | - |
Bos d 11 | Bos d 11.0101 | LQDKIHPFAQ | Sequential / Linear | 60-69 | - | - | IgE from serum of children with cow's milk allergy | - | - | Minor epitope | Western / Immunoblot | 11529896 | - |
Bos d 11 | Bos d 11.0101 | QPLPPTVMFPPQSVLS | Sequential / Linear | 164-179 | - | - | IgE from serum of children with cow's milk allergy | - | - | Minor epitope | Western / Immunoblot | 11529896 | - |
Bos d 11 | Bos d 11.0101 | QSKVLPVPQKAVPYPQRD | Sequential / Linear | 182-199 | - | - | IgE from serum of children with cow's milk allergy | - | - | Minor epitope | Western / Immunoblot | 11529896 | - |
Bos d 11 | Bos d 11.0101 | FAQTQSLVYPFPGPIPNSLPQNI | Sequential / Linear | 67-89 | - | 78152 | IgE from serum of patients with cow's milk allergy | - | - | - | Microarray | 18774394 | - |
Bos d 11 | Bos d 11.0101 | TVMFPPQSVLSLSQSKVLPV | Sequential / Linear | 169-188 | - | 78287 | IgE from serum of patients with cow's milk allergy | - | - | - | Microarray | 18774394 | - |
Bos d 11 | Bos d 11.0101 | RELEELNVPGEIVE | Sequential / Linear | 16-29 | - | - | IgE from serum of children with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 11529896 | - |
Bos d 11 | Bos d 11.0101 | TQSLVYPFPGPIPN | Sequential / Linear | 70-83 | - | - | IgE from serum of children with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 11529896 | - |
Bos d 11 | Bos d 11.0101 | VVPPFLQPEV | Sequential / Linear | 98-107 | - | - | IgE from serum of children with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 11529896 | - |
Bos d 11 | Bos d 11.0101 | KEMPFPKYPVEPFT | Sequential / Linear | 122-135 | - | - | IgE from serum of children with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 11529896 | - |
Bos d 11 | Bos d 11.0101 | LPLPLLQSWM | Sequential / Linear | 150-159 | - | - | IgE from serum of children with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 11529896 | - |
Bos d 11 | Bos d 11.0101 | MPIQAFLLYQEPVLGPVRGPFPII | Sequential / Linear | 200-223 | - | - | IgE from serum of children with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 11529896 | - |
Bos d 12 | Bos d 12.0101 | KDERFFSDKI | Sequential / Linear | 34-43 | - | 30141 | IgE from serum of patients with persistent cow's milk allergy | - | - | - | Western / Immunoblot | 12170271 | - |
Bos d 12 | Bos d 12.0101 | EAVESTVATLED | Sequential / Linear | 158-169 | - | - | IgE from serum of children with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 11529896 | - |
Bos d 12 | Bos d 12.0101 | SPEVIESPPEINTVQVTS | Sequential / Linear | 170-187 | - | - | IgE from serum of children with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 11529896 | - |
Bos d 12 | Bos d 12.0101 | SPPEINTVQV | Sequential / Linear | 176-185 | - | 60178 | IgE from serum of patients with persistent cow's milk allergy | - | - | - | Western / Immunoblot | 12170271 | - |
Bos d 12 | Bos d 12.0101 | RYPSYGLNYYQQKPVALINN | Sequential / Linear | 55-74 | - | 78267 | IgE from serum of patients with cow's milk allergy | - | - | - | Microarray | 18774394 | - |
Bos d 12 | Bos d 12.0101 | IRCEKDERFFSDKIAKYI | Sequential / Linear | 30-47 | - | - | IgE from serum of children with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 11529896 | - |
Bos d 12 | Bos d 12.0101 | KIAKYIPIQYVLSRYPSYGLNYYQ | Sequential / Linear | 42-65 | - | - | IgE from serum of children with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 11529896 | - |
Bos d 12 | Bos d 12.0101 | PVALINNQFLPYPYYAKPAAVR | Sequential / Linear | 68-89 | - | - | IgE from serum of children with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 11529896 | - |
Bos d 12 | Bos d 12.0101 | VRSPAQILQWQV | Sequential / Linear | 88-99 | - | - | IgE from serum of children with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 11529896 | - |
Bos d 12 | Bos d 12.0101 | MARHPHPHLSFMAIPPKKNQDK | Sequential / Linear | 116-137 | - | - | IgE from serum of children with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 11529896 | - |
Bos d 12 | Bos d 12.0101 | PHLSFMAIPPKKNQDKTEIPTINTIA | Sequential / Linear | 122-147 | - | - | IgE from serum of children with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 11529896 | - |
Bos d 4 | Bos d 4.0101 | KCEVFRELKDLKGY | Sequential / Linear | 24-37 | 1F6R 1F6S 1HFZ 2G4N | 30052 | IgE from serum of patients with cow's milk allergy | - | - | - | Radio Immuno Assay | 1720415 | - |
Bos d 4 | Bos d 4.0101 | INYWLAHKALCSEKL | Sequential / Linear | 120-134 | 1F6R 1F6S 1HFZ 2G4N | 558436 | IgE from serum of cow milk-allergic patients | - | - | - | ELISA | 27603546 | - |
Bos d 4 | Bos d 4.0101 | DDQNPHSSNICNISCDK | Sequential / Linear | 82-98 | 2G4N | - | Serum of cow milk-allergic patients | - | - | - | Dot blot | 36307246 | - |
Bos d 4 | Bos d 4.0101 | FLDDDLTDDIMCVK | Sequential / Linear | 99-112 | 2G4N | - | Serum of cow milk-allergic patients | - | - | - | Dot blot | 36307246 | - |
Bos d 4 | Bos d 4.0101 | EQLTKCEVFRELKDLK | Sequential / Linear | 20-35 | 1F6R 1F6S 1HFZ 2G4N | - | IgE from serum of patients with cow's milk allergy | - | - | - | Western / Immunoblot | 11729348 | - |
Bos d 4 | Bos d 4.0101 | KDLKGYGGVSLPEW | Sequential / Linear | 32-45 | 1F6R 1F6S 1HFZ 2G4N | - | IgE from serum of patients with cow's milk allergy | - | - | - | Western / Immunoblot | 11729348 | - |
Bos d 4 | Bos d 4.0101 | STEYGLFQINNK | Sequential / Linear | 66-77 | 1F6R 1F6S 1HFZ 2G4N | 115498 | IgE from serum of patients with cow's milk allergy | - | - | - | Western / Immunoblot | 11729348 | - |
Bos d 4 | Bos d 4.0101 | KKILDKVGIN | Sequential / Linear | 112-121 | 1F6R 1F6S 1HFZ 2G4N | 115317 | IgE from serum of patients with cow's milk allergy | - | - | - | Western / Immunoblot | 11729348 | - |
Bos d 4 | Bos d 4.0101 | EQLTKCEVFRELKDL | Sequential / Linear | 20-34 | 1F6R 1F6S 1HFZ 2G4N | 558421 | IgE from serum of cow milk-allergic patients | - | - | - | ELISA | 27603546 | - |
Bos d 4 | Bos d 4.0101 | CEVFRELKDLKGYGG | Sequential / Linear | 25-39 | 1F6R 1F6S 1HFZ 2G4N | 558390 | IgE from serum of cow milk-allergic patients | - | - | - | ELISA | 27603546 | - |
Bos d 4 | Bos d 4.0101 | DSTEYGLFQINNKIW | Sequential / Linear | 65-79 | 1F6R 1F6S 1HFZ 2G4N | 558411 | IgE from serum of cow milk-allergic patients | - | - | - | ELISA | 27603546 | - |
Bos d 4 | Bos d 4.0101 | NICNISCDKFLDDDL | Sequential / Linear | 90-104 | 1F6R 1F6S 1HFZ 2G4N | 558465 | IgE from serum of cow milk-allergic patients | - | - | - | ELISA | 27603546 | - |
Bos d 5 | Bos d 5.0101 | LIVTQTMKGLDIQKVA | Sequential / Linear | 17-32 | 1B8E 1BSO 1BSQ 1BSY 1QG5 1UZ2 2BLG 2Q2M 2Q2P 2Q39 3BLG 3NPO 3UEV 3UEX 4DQ4 4IB7 4IB8 4IB9 4IBA 4Y0P 4Y0Q | - | IgE from serum of patients with cow's milk allergy | - | - | - | Western / Immunoblot | 11729348 | - |
Bos d 5 | Bos d 5.0101 | WENGECAQK | Sequential / Linear | 77-85 | 4LZU | - | Serum from cow milk-allergic patient | - | - | - | Dot blot | 36307246 | - |
Bos d 5 | Bos d 5.0101 | VLVLDTDYK | Sequential / Linear | 108-116 | 4LZU | - | Serum from cow milk-allergic patient | - | - | - | Dot blot | 36307246 | - |
Bos d 5 | Bos d 5.0101 | TPEVDDEALEK | Sequential / Linear | 141-151 | 4LZU | - | Serum from cow milk-allergic patient | - | - | - | Dot blot | 36307246 | - |
Bos d 5 | Bos d 5.0101 | TPEVDDEALEKFDK | Sequential / Linear | 141-154 | 4LZU | - | Serum from cow milk-allergic patient | - | - | - | Dot blot | 36307246 | - |
Bos d 5 | Bos d 5.0101 | ALPMHIR | Sequential / Linear | 158-164 | 4LZU | - | Serum from cow milk-allergic patient | - | - | - | Dot blot | 36307246 | - |
Bos d 5 | Bos d 5.0101 | LLDAQSAPLRVYVEELKP | Sequential / Linear | 47-64 | 1B0O 1B8E 1BEB 1BSO 1BSQ 1BSY 1CJ5 1DV9 1GXA 1QG5 1UZ2 1YUP 2AKQ 2BLG 2GJ5 2Q2M 2Q2P 2Q39 2R56 3BLG 3KZA 3NPO 3PH5 3PH6 3UEU 3UEV 3UEW 3UEX 4DQ3 4DQ4 4GNY 4IB7 4IB8 4IB9 4IBA 4KII 4LZU 4LZV 4Y0P 4Y0Q 4Y0R | - | IgE from serum of patients with cow's milk allergy | - | - | - | Western / Immunoblot | 11729348 | - |
Bos d 5 | Bos d 5.0101 | KPTPEGDLEILLQK | Sequential / Linear | 63-76 | 1B0O 1B8E 1BEB 1BSO 1BSQ 1BSY 1CJ5 1DV9 1GXA 1QG5 1UZ2 1YUP 2AKQ 2BLG 2GJ5 2Q2M 2Q2P 2Q39 2R56 3BLG 3KZA 3NPO 3PH5 3PH6 3UEU 3UEV 3UEW 3UEX 4DQ3 4DQ4 4GNY 4IB7 4IB8 4IB9 4IBA 4KII 4LZU 4LZV 4Y0P 4Y0Q 4Y0R | - | IgE from serum of patients with cow's milk allergy | - | - | - | Western / Immunoblot | 11729348 | - |
Bos d 5 | Bos d 5.0101 | AQKKIIAEKTKI | Sequential / Linear | 83-94 | 1B0O 1B8E 1BEB 1BSO 1BSQ 1BSY 1CJ5 1DV9 1GXA 1QG5 1UZ2 1YUP 2AKQ 2BLG 2GJ5 2Q2M 2Q2P 2Q39 2R56 3BLG 3NPO 3PH5 3PH6 3UEU 3UEV 3UEW 3UEX 4DQ3 4DQ4 4GNY 4IB7 4IB8 4IB9 4IBA 4KII 4LZU 4LZV 4Y0P 4Y0Q 4Y0R | 3985 | IgE from serum of patients with cow's milk allergy | - | - | - | Western / Immunoblot | 11729348 | - |
Bos d 5 | Bos d 5.0101 | KTKIPAVFKIDA | Sequential / Linear | 91-102 | 1B0O 1B8E 1BEB 1BSO 1BSQ 1BSY 1CJ5 1DV9 1GXA 1QG5 1UZ2 1YUP 2AKQ 2BLG 2GJ5 2Q2M 2Q2P 2Q39 2R56 3BLG 3NPO 3PH5 3PH6 3UEU 3UEV 3UEW 3UEX 4DQ3 4DQ4 4GNY 4IB7 4IB8 4IB9 4IBA 4KII 4LZU 4LZV 4Y0P 4Y0Q 4Y0R | 33732 | IgE from serum of patients with cow's milk allergy | - | - | - | Western / Immunoblot | 11729348 | - |
Bos d 5 | Bos d 5.0101 | EVDDEALEKFDKALKALP | Sequential / Linear | 143-160 | 1B0O 1B8E 1BEB 1BSO 1BSQ 1BSY 1CJ5 1DV9 1GXA 1QG5 1UZ2 1YUP 2AKQ 2BLG 2GJ5 2Q2M 2Q2P 2Q39 2R56 3BLG 3NPO 3PH5 3PH6 3UEU 3UEV 3UEW 3UEX 4DQ3 4DQ4 4GNY 4IB7 4IB8 4IB9 4IBA 4KII 4LZU 4LZV 4Y0P 4Y0Q 4Y0R | - | IgE from serum of patients with cow's milk allergy | - | - | - | Western / Immunoblot | 11729348 | - |
Bos d 5 | Bos d 5.0101 | KALPMHIRLSFNPTQL | Sequential / Linear | 157-172 | 1B0O 1BEB 1BSO 1BSQ 1BSY 1CJ5 1DV9 1GXA 1UZ2 1YUP 2AKQ 2BLG 2GJ5 2Q2M 2Q39 2R56 3BLG 3NPO 3PH5 3PH6 3UEU 3UEV 3UEW 3UEX 4DQ3 4DQ4 4GNY 4IB7 4IB8 4IB9 4IBA 4KII 4LZU 4LZV 4Y0P 4Y0Q 4Y0R | - | IgE from serum of patients with cow's milk allergy | - | - | - | Western / Immunoblot | 11729348 | - |
Bos d 5 | Bos d 5.0101 | RTPEVDDEALE | Sequential / Linear | 140-150 | 1B0O 1B8E 1BEB 1BSO 1BSQ 1BSY 1CJ5 1DV9 1GXA 1QG5 1UZ2 1YUP 2AKQ 2BLG 2GJ5 2Q2M 2Q2P 2Q39 2R56 3BLG 3KZA 3NPO 3PH5 3PH6 3UEU 3UEV 3UEW 3UEX 4DQ3 4DQ4 4GNY 4IB7 4IB8 4IB9 4IBA 4KII 4LZU 4LZV 4Y0P 4Y0Q 4Y0R | 56145 | IgE from serum of patients with cow's milk allergy | - | - | - | Radio Immuno Assay | 1720415 | - |
Bos d 5 | Bos d 5.0102 | LQKWENDECAQKKIIAEKTK | Sequential / Linear | 74-93 | - | 78201 | IgE from serum of patients with cow's milk allergy | - | - | - | Microarray | 18774394 | - |
Bos d 6 | Bos d 6.0101 | EYAV | Sequential / Linear | 363-366 | 4F5S 4JK4 3V03 4OR0 | 14979 | IgE from serum of patients allergic to beef | - | - | - | Antigen Competition / Inhibition ELISA | 12054661 | - |
Bos d 6 | Bos d 6.0101 | LILNR | Sequential / Linear | 478-482 | 4F5S 4JK4 3V03 4OR0 | 36612 | IgE from serum of patients allergic to beef | - | - | - | Antigen Competition / Inhibition ELISA | 12054661 | - |
Bos d 9 | Bos d 9.0101 | NENLLRFFVAPFPEVFGKEK | Sequential / Linear | 32-51 | - | 43705 | IgE from serum of patients with cow's milk allergy | - | - | Major epitope | ELISA | 11174208 | - |
Bos d 9 | Bos d 9.0101 | ELSKDIGSES | Sequential / Linear | 54-63 | - | 13272 | IgE from serum of patients with persistent cow's milk allergy | - | - | - | Western / Immunoblot | 12170271 | - |
Bos d 9 | Bos d 9.0101 | EEIVPNSVEQ | Sequential / Linear | 84-93 | - | 11704 | IgE from serum of patients with persistent cow's milk allergy | - | - | - | Western / Immunoblot | 11678861 | - |
Bos d 9 | Bos d 9.0101 | MKEGIHAQQK | Sequential / Linear | 138-147 | - | 41811 | IgE from serum of patients with persistent cow's milk allergy | - | - | - | Western / Immunoblot | 12170271 | - |
Bos d 9 | Bos d 9.0101 | NENLLRFFVAPFPE | Sequential / Linear | 32-45 | - | 43704 | IgE from serum of patients with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 12897753 | - |
Bos d 9 | Bos d 9.0101 | FFVAPFPEVFGKEK | Sequential / Linear | 38-51 | - | 15931 | IgE from serum of patients with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 12897753 | - |
Bos d 9 | Bos d 9.0101 | ERYLGYLEQLLRLK | Sequential / Linear | 104-117 | - | 14100 | IgE from serum of patients with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 12897753 | - |
Bos d 9 | Bos d 9.0101 | LEIVPNSAEERL | Sequential / Linear | 124-135 | - | 35530 | IgE from serum of patients with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 12897753 | - |
Bos d 9 | Bos d 9.0101 | NQELAYFYPELFRQ | Sequential / Linear | 154-167 | - | 45540 | IgE from serum of patients with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 12897753 | - |
Bos d 9 | Bos d 9.0101 | YPSGAWYYVPLGTQ | Sequential / Linear | 174-187 | - | 75410 | IgE from serum of patients with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 12897753 | - |
Bos d 9 | Bos d 9.0101 | YTDAPSFSDIPNPI | Sequential / Linear | 188-201 | - | 75991 | IgE from serum of patients with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 12897753 | - |
Bos d 9 | Bos d 9.0101 | KEDVPSERYLGYLEQLLRLK | Sequential / Linear | 98-117 | - | 30334 | IgE from serum of patients with cow's milk allergy | - | - | Major epitope | ELISA | 11174208 | - |
Bos d 9 | Bos d 9.0101 | FSDIPNPIGSENSE | Sequential / Linear | 194-207 | - | 17690 | IgE from serum of patients with cow's milk allergy | - | - | Major epitope | Western / Immunoblot | 12897753 | - |
Bos d 9 | Bos d 9.0101 | FPEVFGKEKVNELSKDIGSESTE | Sequential / Linear | 43-65 | - | 78158 | IgE from serum of patients with cow's milk allergy | - | - | - | Microarray | 18774394 | - |
Bos d 9 | Bos d 9.0101 | LNENLLRFFVAPFPEVFGKE | Sequential / Linear | 31-50 | - | 38207 | IgE from serum of patients with cow's milk allergy | - | - | Immunodominant epitope | Fluorescence Immuno Assay and Antigen Competition | 15541041 | - |
Bos d 9 | Bos d 9.0101 | IGVNQELAYFYPELFRQFYQ | Sequential / Linear | 151-170 | - | 26341 | IgE from serum of patients with cow's milk allergy | - | - | Immunodominant epitope | Fluorescence Immuno Assay and Antigen Competition | 15541041 | - |
Bos d 9 | Bos d 9.0101 | IKHQGLPQEVLNENL | Sequential / Linear | 21-35 | - | 190448 | IgE from serum of patients with cow's milk allergy | - | - | Immunodominant epitope | ELISA | 24035023 | - |
Bos d 9 | Bos d 9.0101 | LPQEVLNENLLRFFV | Sequential / Linear | 25-40 | - | 190475 | IgE from serum of patients with cow's milk allergy | - | - | Immunodominant epitope | ELISA | 24035023 | - |
Bos d 9 | Bos d 9.0101 | VEQKHIQKEDVPSER | Sequential / Linear | 91-105 | - | 190571 | IgE from serum of patients with cow's milk allergy | - | - | Immunodominant epitope | ELISA | 24035023 | - |
Bos d 9 | Bos d 9.0101 | GIHAQQKEPMIGVNQ | Sequential / Linear | 141-155 | - | 190431 | IgE from serum of patients with cow's milk allergy | - | - | Immunodominant epitope | ELISA | 24035023 | - |
Bos d 9 | Bos d 9.0101 | TQYTDAPSFSDIPNP | Sequential / Linear | 186-200 | - | 190562 | IgE from serum of patients with cow's milk allergy | - | - | Immunodominant epitope | ELISA | 24035023 | - |
Bos d 9 | Bos d 9.0101 | NLLRFFVAPFPE | Sequential / Linear | 34-45 | - | - | Alpha casein-specific mAb 1D5 | - | - | - | Dot blot, MALDI-TOF MS | 28643898 | Gly m 5 cross-reactive epitope |
Bos d 9 | Bos d 9.0101 | LEIVPNSAEERL | Sequential / Linear | 124-135 | - | 35530 | IgE from serum of patients with cow's milk allergy | - | - | Major epitope | ELISA and Western / Immunoblot | 11174208 | - |
Bos d 9 | Bos d 9.0101 | YLGYLEQLLR | Sequential / Linear | 96-105 | - | - | Alpha casein-specific mAb 1D5 | - | - | - | Dot blot, MALDI-TOF MS | 28643898 | Gly m 5 cross-reactive epitope |
Bos d 9 | Bos d 9.0101 | QLLRLKKYKVPQLE | Sequential / Linear | 112-125 | - | - | Alpha casein-specific mAb 1D5 | - | - | - | Dot blot, MALDI-TOF MS | 28643898 | Gly m 5 cross-reactive epitope |
Bos d 9 | Bos d 9.0101 | RPKHPIKHQGLPQEVLNE | Sequential / Linear | 16-33 | - | - | Alpha casein-specific mAb 1D5 | - | - | - | Dot blot, MALDI-TOF MS | 28643898 | Gly m 5 cross-reactive epitope |
Bos d 9 | Bos d 9.0101 | EDVPSER | Sequential / Linear | 99-105 | - | - | Serum of cow milk-allergic patients | - | - | - | Dot blot | 36307246 | - |
Bos d 9 | Bos d 9.0101 | EGIHAQQK | Sequential / Linear | 140-147 | - | - | Serum of cow milk-allergic patients | - | - | - | Dot blot | 36307246 | - |
Bos d 9 | Bos d 9.0101 | NQELAYFYPELFRQF | Sequential / Linear | 154-168 | - | 45541 | IgE from serum of patients with cow's milk allergy | - | - | Major epitope | ELISA | 11174208 | - |
Bos d 9 | Bos d 9.0101 | YPSGAWYYVPLGTQYT | Sequential / Linear | 174-189 | - | 75411 | IgE from serum of patients with cow's milk allergy | - | - | Major epitope | ELISA | 11174208 | - |
Bos d 9 | Bos d 9.0101 | YTDAPSFSDIPNPIGSENSEKT | Sequential / Linear | 188-209 | - | 75992 | IgE from serum of patients with cow's milk allergy | - | - | Major epitope | ELISA | 11174208 | - |
Bos d 9 | Bos d 9.0101 | ELSKDIGSES | Sequential / Linear | 54-63 | - | 13272 | IgE from serum of patients with cow's milk allergy | - | - | Minor epitope | ELISA | 11174208 | - |
Bos d 9 | Bos d 9.0101 | EEIVPNSVEQ | Sequential / Linear | 84-93 | - | 11704 | IgE from serum of patients with cow's milk allergy | - | - | Minor epitope | ELISA | 11174208 | - |
Bos d 9 | Bos d 9.0101 | MKEGIHAQQK | Sequential / Linear | 138-147 | - | 41811 | IgE from serum of patients with cow's milk allergy | - | - | Minor epitope | ELISA and Western / Immunoblot | 11174208 | - |
Bos d COL1A2 | - | IPGEFGLPGP | Sequential / Linear | 573-582 | - | 27850 | IgE from serum of patients allergic to bovine gelatin | - | - | Major epitope | Antigen Competition | 12373276 | - |
Can f 6 | Can f 6.0101 | SDIKEKIEENGS | Sequential / Linear | 43-54 | 5X7Y | 738246 | Sera from Dog allergic children | - | - | - | ELISA | 29207604 | - |
Can f 6 | Can f 6.0101 | TKVNGKCT | Sequential / Linear | 76-83 | 5X7Y | 738266 | Sera from Dog allergic children | - | - | - | ELISA | 29207604 | - |
Can f 6 | Can f 6.0101 | KTEKDGE | Sequential / Linear | 91-97 | 5X7Y | 738174 | Sera from Dog allergic children | - | - | - | ELISA | 29207604 | - |
Can f 6 | Can f 6.0101 | NVNQEQEF | Sequential / Linear | 125-132 | 5X7Y | 738216 | Sera from Dog allergic children | - | - | - | ELISA | 29207604 | - |
Can f 6 | Can f 6.0101 | GRKPDVSPKVKEKF | Sequential / Linear | 139-152 | 5X7Y | 738153 | Sera from Dog allergic children | - | - | - | ELISA | 29207604 | - |
Can f 7 | Can f 7.0101 | TYSYLNKLPVKN | Sequential / Linear | 106-117 | - | 871379 | Serum from Dog-allergic children | - | - | - | ELISA | 30664181 | - |
Can f 7 | Can f 7.0101 | PSIKLVVQW | Sequential / Linear | 120-128 | - | 871006 | Serum from Dog-allergic children | - | - | - | ELISA | 30664181 | - |
Car i 4 | Car i 4.0101 | PHYSNAPQLVYI | Sequential / Linear | 88-99 | - | 157741 | IgE from pooled serum of Pecan allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | GRQQHKFGQCQL | Sequential / Linear | 28-39 | - | 157343 | IgE from pooled serum of Pecan allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | SQQGQRREFQQD | Sequential / Linear | 124-135 | - | 158291 | IgE from pooled serum of Pecan allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | GQRREFQQDRHQ | Sequential / Linear | 127-138 | - | 157340 | IgE from pooled serum of Pecan allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | QQDRHQKIRHFR | Sequential / Linear | 133-144 | - | 157808 | IgE from pooled serum of Pecan allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | QEYEQHRRQQQH | Sequential / Linear | 205-216 | - | 157770 | IgE from pooled serum of Pecan allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | NNVFSGFDAEFL | Sequential / Linear | 232-243 | - | 157725 | IgE from pooled serum of Pecan allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | FSGFDAEFLADA | Sequential / Linear | 235-246 | - | 157280 | IgE from pooled serum of Pecan allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | HSVVYALRGRAE | Sequential / Linear | 385-396 | - | 157381 | IgE from pooled serum of Pecan allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | PQNFAVVKRARD | Sequential / Linear | 421-432 | - | 157762 | IgE from pooled serum of Pecan allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | FAVVKRARDEGF | Sequential / Linear | 424-435 | - | 157228 | IgE from pooled serum of Pecan allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | EESQRQSQQGQR | Sequential / Linear | 118-129 | - | 157186 | IgE from pooled serum of Pecan allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | QRQSQQGQRREF | Sequential / Linear | 121-132 | - | 157812 | IgE from pooled serum of Pecan allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | REFQQDRHQKIR | Sequential / Linear | 130-141 | - | 157835 | IgE from pooled serum of Pecan allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | QGQQEYEQHRRQ | Sequential / Linear | 202-213 | - | 157773 | IgE from pooled serum of Pecan allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | EQHRRQQQHQQR | Sequential / Linear | 208-219 | - | 157218 | IgE from pooled serum of Pecan allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | FDAEFLADAFNV | Sequential / Linear | 238-249 | - | 157230 | IgE from pooled serum of Pecan allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | ERRQSRRGGRDD | Sequential / Linear | 304-315 | - | 157220 | IgE from pooled serum of Pecan allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 21718052 | - |
Car i 4 | Car i 4.0101 | LNAHSVVYALRG | Sequential / Linear | 382-393 | - | 157603 | IgE from pooled serum of Pecan allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 21718052 | - |
Cha o 2 | Cha o 2.0101 | KVVNGRTV | Sequential / Linear | 169-176 | - | - | Monoclonal antibody (mAb) T27 | - | - | - | ELISA | 26916996 | Cross-reactive epitope |
Chi t 1 | Chi t 1.0101 | GVTHDQLNNFR | Sequential / Linear | 106-116 | 1ECA 1ECD 1ECN 1ECO | 23169 | IgE from serum of patients allergic to Chi t 1 | - | - | - | Radio Immuno Assay | 2464134 | - |
Chla n Trp | - | KMQAMKVDRENAQDL | Sequential / Linear | 7-21 | - | 1391868 | Sera from scallop-sensitive patients | - | - | - | ELISA | 33960998 | - |
Chla n Trp | - | QDLAEQMEQKLKDTE | Sequential / Linear | 19-33 | - | 1391906 | Sera from scallop-sensitive patients | - | - | - | ELISA | 33960998 | - |
Chla n Trp | - | NNYDTVNEQLQE | Sequential / Linear | 55-66 | - | 1391892 | Sera from scallop-sensitive patients | - | - | - | ELISA | 33960998 | - |
Chla n Trp | - | KQITQLESDVGG | Sequential / Linear | 76-87 | - | 1391870 | Sera from scallop-sensitive patients | - | - | - | ELISA | 33960998 | - |
Chla n Trp | - | ADESERNRKVLEGRS | Sequential / Linear | 120-134 | - | 1391810 | Sera from scallop-sensitive patients | - | - | - | ELISA | 33960998 | - |
Chla n Trp | - | SNSYEERIDELEKQL | Sequential / Linear | 134-148 | - | 1391927 | Sera from scallop-sensitive patients | - | - | - | ELISA | 33960998 | - |
Chla n Trp | - | KVLELEEELTVVGA | Sequential / Linear | 189-202 | - | 1391871 | Sera from scallop-sensitive patients | - | - | - | ELISA | 33960998 | - |
Cla c 14 | Cla c 14.0101 | TDAVPQKLKAEDVAKLDIEKKS | Sequential / Linear | 257-278 | - | - | IgE from pooled serum of C. cladosporioides-sensitized patients with bronchial asthma | - | - | - | Western / Immunoblot | 21488999 | - |
Coc n 1 | Coc n 1.0101 | MEGREKRVEEKAPRSPEDR | Sequential / Linear | 35-53 | - | - | Pooled sera from Coconut pollen allergic patients | - | - | Immunodominant epitope | ELISA | 33486354 | - |
Coc n 1 | Coc n 1.0101 | FTTSARKNRPQF | Sequential / Linear | 409-420 | - | - | Pooled sera from Coconut pollen allergic patients | - | - | Immunodominant epitope | ELISA | 33486354 | - |
Coc n 1 | Coc n 1.0101 | EEINGKKWKGEE | Sequential / Linear | 469-480 | - | - | Pooled sera from Coconut pollen allergic patients | - | - | Immunodominant epitope | ELISA | 33486354 | - |
Cor a 1 | Cor a 1.0101 | YVLDGDKLLPKVAPQAL | Sequential / Linear | 23-39 | - | 76332 | IgE from pollen allergic patients | - | - | - | Competitive binding | 2477335 | - |
Cor a 9 | Cor a 9.0101 | QRSEQDRHQKIRHFR | Sequential / Linear | 137-151 | - | 114553 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | PQQQSQQGQRQGQGQ | Sequential / Linear | 121-135 | - | 114521 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | QRQGQGQSQRSEQDR | Sequential / Linear | 129-143 | - | 114552 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | GDIIALPAGVAHWCY | Sequential / Linear | 153-167 | - | 114352 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | DGDSPVVTVSLLHTN | Sequential / Linear | 169-183 | - | 114295 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | YANQLDENPRHFYLA | Sequential / Linear | 185-199 | - | 114680 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | IVKVEGRLQVVRPER | Sequential / Linear | 273-287 | - | 114425 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | RQEWERQERQERESE | Sequential / Linear | 289-293 | - | 114587 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | RQERESEQERERQRR | Sequential / Linear | 297-311 | - | 114586 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | ERERQRRQGGRGRDV | Sequential / Linear | 305-319 | - | 114325 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | GGRGRDVNGFEETIC | Sequential / Linear | 313-327 | - | 114359 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | NPDDEHQRQGQQQFG | Sequential / Linear | 201-215 | - | 114495 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | VLRWLQLSAERGDLQ | Sequential / Linear | 361-375 | - | 114655 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | RAESEGFEWVAFKTN | Sequential / Linear | 433-447 | - | 114559 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | AFQISREEARRLKYN | Sequential / Linear | 473-487 | - | 114258 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | ARRLKYNRQETTLVR | Sequential / Linear | 481-495 | - | 114268 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | QETTLVRSSRSSSER | Sequential / Linear | 489-503 | - | 114529 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | SRSSSERKRRSESEG | Sequential / Linear | 497-511 | - | 114618 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | QGQQQFGQRRRQQQH | Sequential / Linear | 209-223 | - | 114532 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | FSGFDAEFLADAFNV | Sequential / Linear | 241-255 | - | 114342 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | QVVRPERSRQEWERQ | Sequential / Linear | 281-295 | - | 114558 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | MAKLILVSFSLCLLV | Sequential / Linear | 1-15 | - | 114467 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | CQIESWDHNDQQFQC | Sequential / Linear | 57-71 | - | 114283 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | PQYSNAPELIYIERG | Sequential / Linear | 89-103 | - | 114522 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cor a 9 | Cor a 9.0101 | LIYIERGRGITGVLF | Sequential / Linear | 97-111 | - | 114454 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Cra a 2 | Cra a 2.0101 | SGAGVYACDPEGYEVFKE | Sequential / Linear | 56-73 | - | 1641094 | IgE from sera of Oyster-sensitive patients | - | - | - | Dot blot, ELISA | 34664604 | - |
Cra a 2 | Cra a 2.0101 | PLDATGEFIVSTRV | Sequential / Linear | 105-118 | - | 2145105 | IgE from sera of Oyster-allergic patients | - | - | - | Dot blot,iELISA | 36205062 | - |
Cra a 2 | Cra a 2.0101 | YKRLVSAIKQLE | Sequential / Linear | 236-247 | - | 2145266 | IgE from sera of Oyster-allergic patients | - | - | - | Dot blot,iELISA | 36205062 | - |
Cra a 2 | Cra a 2.0101 | PVIMDYHKVDKVEHPP | Sequential / Linear | 77-92 | - | 1640420 | IgE from sera of Oyster-sensitive patients | - | - | - | Dot blot, ELISA | 34664604 | - |
Cra a 2 | Cra a 2.0101 | CDFGPQDKLGFDPLD | Sequential / Linear | 93-107 | - | 1636526 | IgE from sera of Oyster-sensitive patients | - | - | - | Dot blot, ELISA | 34664604 | - |
Cra a 2 | Cra a 2.0101 | GRSHEGYPFPPVS | Sequential / Linear | 121-133 | - | 1637924 | IgE from sera of Oyster-sensitive patients | - | - | - | Dot blot, ELISA | 34664604 | - |
Cra a 2 | Cra a 2.0101 | TDEQRKEMENKTI | Sequential / Linear | 134-146 | - | 1641532 | IgE from sera of Oyster-sensitive patients | - | - | - | Dot blot, ELISA | 34664604 | - |
Cra a 2 | Cra a 2.0101 | TMTPEENQQLID | Sequential / Linear | 165-176 | - | 1641742 | IgE from sera of Oyster-sensitive patients | - | - | - | Dot blot, ELISA | 34664604 | - |
Cra a 2 | Cra a 2.0101 | DKMLGDAGGYNGWPKA | Sequential / Linear | 185-200 | - | 1636755 | IgE from sera of Oyster-sensitive patients | - | - | - | Dot blot, ELISA | 34664604 | - |
Cra a 2 | Cra a 2.0101 | QKGGDVGEVYKR | Sequential / Linear | 227-238 | - | 1640530 | IgE from sera of Oyster-sensitive patients | - | - | - | Dot blot, ELISA | 34664604 | - |
Cra a 2 | Cra a 2.0101 | GEHTESVGGVYDISNKRR | Sequential / Linear | 306-323 | - | 1637670 | IgE from sera of Oyster-sensitive patients | - | - | - | Dot blot, ELISA | 34664604 | - |
Cra a 4 | Cra a 4.0101 | KISIEDVEESRN | Sequential / Linear | 22-33 | - | 1558351 | Sera from Oyster-allergic patients | - | - | - | ELISA | 34338271 | - |
Cra a 4 | Cra a 4.0101 | TGAGKEISESEF | Sequential / Linear | 64-75 | - | 1560554 | Sera from Oyster-allergic patients | - | - | - | ELISA | 34338271 | - |
Cra a 4 | Cra a 4.0101 | TEAYKKDKVGF | Sequential / Linear | 80-90 | - | 1560537 | Sera from Oyster-allergic patients | - | - | - | ELISA | 34338271 | - |
Cra a 4 | Cra a 4.0101 | TNKDRTIDED | Sequential / Linear | 107-116 | - | 1560631 | Sera from Oyster-allergic patients | - | - | - | ELISA | 34338271 | - |
Cra a 4 | Cra a 4.0101 | NKHVPLKDIVSEWVKF | Sequential / Linear | 144-159 | - | 1559312 | Sera from Oyster-allergic patients | - | - | - | ELISA | 34338271 | - |
Cra a Trp | - | KENAQDR | Sequential / Linear | 15-21 | - | 2116381 | IgE from Oyster-sensitive patients | - | - | - | Dot blot,ELISA | 35848932 | - |
Cra a Trp | - | LAEKERYK | Sequential / Linear | 261-268 | - | 2116382 | IgE from Oyster-sensitive patients | - | - | - | Dot blot,ELISA | 35848932 | - |
Cra a Trp | - | QQLRDTEEQKAKIEE | Sequential / Linear | 27-41 | - | 2116399 | IgE from Oyster-sensitive patients | - | - | - | Dot blot,ELISA | 35848932 | - |
Cra a Trp | - | LTSLQKKHS | Sequential / Linear | 43-51 | - | 2116383 | IgE from Oyster-sensitive patients | - | - | - | Dot blot,ELISA | 35848932 | - |
Cra a Trp | - | NEKYQECQTKMEEAEK | Sequential / Linear | 61-76 | - | 2116386 | IgE from Oyster-sensitive patients | - | - | - | Dot blot,ELISA | 35848932 | - |
Cra a Trp | - | EIQSLNR | Sequential / Linear | 84-90 | - | 2116376 | IgE from Oyster-sensitive patients | - | - | - | Dot blot,ELISA | 35848932 | - |
Cra a Trp | - | AARKLAITEV | Sequential / Linear | 165-174 | - | 2116370 | IgE from Oyster-sensitive patients | - | - | - | Dot blot,ELISA | 35848932 | - |
Cra a Trp | - | RLEAAEAKVYE | Sequential / Linear | 182-192 | - | 2116400 | IgE from Oyster-sensitive patients | - | - | - | Dot blot,ELISA | 35848932 | - |
Cra a Trp | - | QLSVVANNIKTL | Sequential / Linear | 196-207 | - | 2116398 | IgE from Oyster-sensitive patients | - | - | - | Dot blot,ELISA | 35848932 | - |
Cra a Trp | - | SQREDSYEET | Sequential / Linear | 215-224 | - | 2116402 | IgE from Oyster-sensitive patients | - | - | - | Dot blot,ELISA | 35848932 | - |
Cra g 1 | Cra g 1.0101 | IQLLEEDMERSEER | Sequential / Linear | 92-105 | - | - | IgE from serum of subjects allergic to mollusks and crustaceans | - | - | - | ELISA | DOI:10.1111/j.1365-2621.1998.tb15672.x | - |
Cra g 1 | Cra g 1.0102 | TSLQKK | Sequential / Linear | 44-49 | - | 886613 | IgE from pooled sera of Oyster allergic patients | - | - | Immunodominant epitope | ELISA | 30807831 | - |
Cra g 1 | Cra g 1.0102 | TKLEEAEKTASEAEQEI | Sequential / Linear | 69-85 | - | 886612 | IgE from pooled sera of Oyster allergic patients | - | - | Immunodominant epitope | ELISA | 30807831 | - |
Cra g 1 | Cra g 1.0102 | MERSEERLQT | Sequential / Linear | 99-108 | - | 886606 | IgE from pooled sera of Oyster allergic patients | - | - | Immunodominant epitope | ELISA | 30807831 | - |
Cra g 1 | Cra g 1.0102 | NNASEERTDVL | Sequential / Linear | 134-144 | - | 886608 | IgE from pooled sera of Oyster allergic patients | - | - | Immunodominant epitope | ELISA | 30807831 | - |
Cra g 1 | Cra g 1.0102 | VQNDQASQREDSYEET | Sequential / Linear | 209-224 | - | 886615 | IgE from pooled sera of Oyster allergic patients | - | - | Immunodominant epitope | ELISA | 30807831 | - |
Cra g AK | - | LKDKKTK | Sequential / Linear | 32-38 | - | 1853715 | Sera of Oyster-allergic patients | - | - | - | ELISA | 34837649 | - |
Cra g AK | - | VEHP | Sequential / Linear | 88-91 | - | 1854983 | Sera of Oyster-allergic patients | - | - | - | ELISA | 34837649 | - |
Cra g AK | - | GRSHE | Sequential / Linear | 121-125 | - | 1853115 | Sera of Oyster-allergic patients | - | - | - | ELISA | 34837649 | - |
Cra g AK | - | VSTDEQRKDMEN | Sequential / Linear | 132-143 | - | 1855116 | Sera of Oyster-allergic patients | - | - | - | ELISA | 34837649 | - |
Cra g AK | - | ELK | Sequential / Linear | 155-157 | - | 1852830 | Sera of Oyster-allergic patients | - | - | - | ELISA | 34837649 | - |
Cra g AK | - | QLEKK | Sequential / Linear | 245-249 | - | 1854439 | Sera of Oyster-allergic patients | - | - | - | ELISA | 34837649 | - |
Cra g AK | - | EHT | Sequential / Linear | 307-309 | - | 1852820 | Sera of Oyster-allergic patients | - | - | - | ELISA | 34837649 | - |
Cra g SCP | - | LDADKDNKITPED | Sequential / Linear | 15-27 | - | 1852276 | IgE from pooled sera | - | - | Immunodominant epitope | ELISA | 34854091 | - |
Cra g SCP | - | FDNTKW | Sequential / Linear | 53-58 | - | 1852214 | IgE from pooled sera | - | - | Immunodominant epitope | ELISA | 34854091 | - |
Cra g SCP | - | QKDK | Sequential / Linear | 86-89 | - | 1852323 | IgE from pooled sera | - | - | Immunodominant epitope | ELISA | 34854091 | - |
Cra g SCP | - | ENMDRPIQEQ | Sequential / Linear | 109-118 | - | 1852211 | IgE from pooled sera | - | - | Immunodominant epitope | ELISA | 34854091 | - |
Cra g SCP | - | DDDQSK | Sequential / Linear | 164-169 | - | 1852198 | IgE from pooled sera | - | - | Immunodominant epitope | ELISA | 34854091 | - |
Cry j 1 | Cry j 1.0101 | NGNATPQLTKNA | Sequential / Linear | 352-363 | - | 44035 | IgE from pooled serum of Japanese cedar-allergic patients | - | - | - | Western / Immunoblot and Antigen Competition | 16079500 | - |
Cry j 2 | Cry j 2.0101 | KWVNGREI | Sequential / Linear | 169-176 | - | 34335 | IgE from serum of patients with CJ pollinosis | - | - | Major epitope | ELISA and Antigen Competition | 12580914 | - |
Cry j 2 | Cry j 2.0101 | GRENSRAEVSYVHVNGAKFI | Sequential / Linear | 285-305 | - | 22022 | IgE from serum of patients with CJ pollinosis | - | - | - | Inhibition ELISA | 23504147 | - |
Cry j 2 | Cry j 2.0101 | TYKNIRGTSATAAAIQLKCS | Sequential / Linear | 366-385 | - | 188551 | IgE from serum of patients with CJ pollinosis | - | - | - | Inhibition ELISA | 23504147 | - |
Cuc m 2 | Cuc m 2.0101 | FLGGTKYMVI | Sequential / Linear | 66-75 | - | 16615 | IgE from serum of melon allergic patients | - | - | Major epitope | Western / Immunoblot | 17397911 | - |
Cuc m 2 | Cuc m 2.0101 | AVIRGKKGSG | Sequential / Linear | 81-90 | - | 5385 | IgE from serum of melon allergic patients | - | - | Major epitope | Western / Immunoblot | 17397911 | - |
Cuc m 2 | Cuc m 2.0101 | GITVKKTNQA | Sequential / Linear | 91-100 | - | 20468 | IgE from serum of melon allergic patients | - | - | Major epitope | Western / Immunoblot | 17397911 | - |
Cuc m 2 | Cuc m 2.0101 | LGDYLIEQGL | Sequential / Linear | 122-131 | - | 36083 | IgE from serum of melon allergic patients | - | - | Major epitope | Western / Immunoblot | 17397911 | - |
Cuc m 2 | Cuc m 2.0101 | YVDDHLMCDIDGNRL | Sequential / Linear | 8-20 | - |
( ! ) Deprecated: Function split() is deprecated in C:\wamp\www\AllerBase\PHP_codes\BrSeqEpi.php on line 606 |
Call Stack |
# | Time | Memory | Function | Location |
1 | 0.0008 | 791440 | {main}( ) | ..\BrSeqEpi.php:0 |
76244 37997
| IgE from serum of melon allergic patients | - | - | Minor epitope | Western / Immunoblot | 17397911 | - |
Cuc m 2 | Cuc m 2.0101 | SATFPAFRLEEIAAILKDFD | Sequential / Linear | 36-55 | - |
( ! ) Deprecated: Function split() is deprecated in C:\wamp\www\AllerBase\PHP_codes\BrSeqEpi.php on line 606 |
Call Stack |
# | Time | Memory | Function | Location |
1 | 0.0008 | 791440 | {main}( ) | ..\BrSeqEpi.php:0 |
57012 12382
| IgE from serum of melon allergic patients | - | - | Minor epitope | Western / Immunoblot | 17397911 | - |
Cuc m 2 | Cuc m 2.0101 | YDEPLTPGQCNMIVE | Sequential / Linear | 106-120 | - |
( ! ) Deprecated: Function split() is deprecated in C:\wamp\www\AllerBase\PHP_codes\BrSeqEpi.php on line 606 |
Call Stack |
# | Time | Memory | Function | Location |
1 | 0.0008 | 791440 | {main}( ) | ..\BrSeqEpi.php:0 |
73542 65586
| IgE from serum of melon allergic patients | - | - | Minor epitope | Western / Immunoblot | 17397911 | - |
Cur l 3 | Cur l 3.0101 | QGDAKKGANLFKTRC | Sequential / Linear | 5-19 | - | 108599 | IgE from serum of Curvularia allergic patients | - | - | - | ELISA and Antigen Competition | 19290623 | - |
Cur l 3 | Cur l 3.0101 | TRCAQCHTLK | Sequential / Linear | 17-26 | - | 108666 | IgE from serum of Curvularia allergic patients | - | - | - | ELISA and Antigen Competition | 19290623 | - |
Cur l 3 | Cur l 3.0101 | LKAGEGNKIGPE | Sequential / Linear | 25-36 | - | 108523 | IgE from serum of Curvularia allergic patients | - | - | - | ELISA and Antigen Competition | 19290623 | - |
Cur l 3 | Cur l 3.0101 | TDANKQKGIEWNHDT | Sequential / Linear | 54-68 | - | 108649 | IgE from serum of Curvularia allergic patients | - | - | - | ELISA and Antigen Competition | 19290623 | - |
Cur l 3 | Cur l 3.0101 | ENPKKYIPGTK | Sequential / Linear | 74-84 | - | 108345 | IgE from serum of Curvularia allergic patients | - | - | - | ELISA and Antigen Competition | 19290623 | - |
Cur l 3 | Cur l 3.0101 | LKKPKDRNDLI | Sequential / Linear | 90-100 | - | 108525 | IgE from serum of Curvularia allergic patients | - | - | - | ELISA and Antigen Competition | 19290623 | - |
Cur l ADH | - | MSNIPQEQW | Sequential / Linear | 1-9 | - | 147140 | IgE from pooled serum of Curvularia-allergic patients | - | - | - | ELISA | 21647452 | - |
Cur l ADH | - | EKTGGPVEYKKIPVQKPGPDE | Sequential / Linear | 14-34 | - | 146883 | IgE from pooled serum of Curvularia-allergic patients | - | - | - | ELISA | 21647452 | - |
Cur l ADH | - | AVNGDWPLPTKLPLVGGH | Sequential / Linear | 51-68 | - | 146786 | IgE from pooled serum of Curvularia-allergic patients | - | - | - | ELISA | 21647452 | - |
Cur l ADH | - | LKESGVKPGQFAAIVGAGGGL | Sequential / Linear | 164-184 | - | 147092 | IgE from pooled serum of Curvularia-allergic patients | - | - | - | ELISA | 21647452 | - |
Cyn d 1 | Cyn d 1.0101 | CRACYEIKCK | Sequential / Linear | 70-79 | - | 174069 | IgE from serum of Bermuda grass pollen allergic patients | - | - | Major epitope | Western / Immunoblot | 21985791 | - |
Cyn d 1 | Cyn d 1.0101 | IAAYHFDLSG | Sequential / Linear | 101-110 | - | 174146 | IgE from serum of Bermuda grass pollen allergic patients | - | - | Major epitope | Western / Immunoblot | 21985791 | - |
Cyn d 1 | Cyn d 1.0101 | HYLALLVKY | Sequential / Linear | 159-167 | - | 174145 | IgE from serum of Bermuda grass pollen allergic patients | - | - | Major epitope | Western / Immunoblot | 21985791 | - |
Cyn d 1 | Cyn d 1.0101 | GNIVAVDIKP | Sequential / Linear | 172-181 | - | 174123 | IgE from serum of Bermuda grass pollen allergic patients | - | - | Major epitope | Western / Immunoblot | 21985791 | - |
Cyn d 1 | Cyn d 1.0201 | QDDVIPEDWKPDTVYKSKIQF | Sequential / Linear | 224-244 | - | 104948 | IgE from serum of Bermuda grass pollen allergic patients | - | - | Major epitope | Immunoblot and ELISA | 19187539 | - |
Cyn d 1 | Cyn d 1.0201 | EEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAG | Sequential / Linear | 121-170 | - | 104761 | IgE from serum of Bermuda grass pollen allergic patients | - | - | Major epitope | Immunoblot and ELISA | 19187539 | - |
Dan re COL1A2 | - | MKGLRGHPGLQGMPGPNGPS | Sequential / Linear | 1009-1028 | - | 138792 | IgE from serum of Fish allergic patients | - | - | Major epitope | ELISA | 20827051 | - |
Der f 14 | Der f 14.0101 | SPVTKRASLKIDSKK | Sequential / Linear | 56-70 | - | 60327 | IgE from serum of mite allergic patients | - | - | - | Western / Immunoblot | 7510559 | - |
Der f 14 | Der f 14.0101 | DVELSLRSSDIA | Sequential / Linear | 104-115 | - | 10579 | IgE from serum of mite allergic patients | - | - | - | Western / Immunoblot and Antigen Competition | 7510559 | - |
Der f 1 | - | SAYLAYRN | Sequential / Linear | 144-151 | 3RVV 3D6S | 558178 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | GenBank: EU095368.1 |
Der f 1 | - | GCHGDTIP | Sequential / Linear | 169-176 | 3RVV 3D6S | 558069 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | GenBank: EU095368.1 |
Der f 1 | - | AREQQCRRPNSQ | Sequential / Linear | 197-208 | - | 558007 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | GenBank: EU095368.1 |
Der f 1 | - | GSTQGVDY | Sequential / Linear | 277-284 | - | 558083 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | GenBank: EU095368.1 |
Der f 2 | Der f 2.0101 | DQVDVKDCANNEIKKVMVDGCHGSDPCII | Sequential / Linear | 18-46 | 1AHK 1AHM | 9918 | IgE from serum of mite sensitive atopic patients | - | - | - | Western / Immunoblot and Antigen Competition | 9224967 | - |
Der f 2 | Der f 2.0101 | IAT | Sequential / Linear | 138-140 | 1AHK 1AHM 1XWV 2F08 1WRF | 96373 | IgE from serum of mite sensitive atopic patients | - | - | - | Western / Immunoblot and Antigen Competition | 9224967 | - |
Der f 24 | Der f 24.0101 | MVHLTKTLRFINNPGFRKFYYGLQGYNKYGLY | Sequential / Linear | 1-32 | - | 913688 | Serum from House dust mite allergic patients | - | - | Immunodominant epitope | ELISA,Dot-blot | 31545417 | - |
Der f 2 | - | KVMVDGCH | Sequential / Linear | 32-39 | 1AHK 1AHM 1XWV 2F08 1WRF | 558105 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | GenBank: FJ436110.1 |
Der f 2 | - | LVKGQQYDIK | Sequential / Linear | 97-106 | 1AHK 1AHM 2F08 1WRF | 558110 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | GenBank: FJ436110.1 |
Der f 2 | - | VTVKLIGD | Sequential / Linear | 123-130 | 1AHK 1AHM 2F08 1WRF | 558207 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | GenBank: FJ436110.1 |
Der f 3 | Der f 3.0101 | KAKAGDCP | Sequential / Linear | 33-40 | - | - | | - | - | Strongly reacting epitope | IgE specific assay | 25345157 | GenBank Protein: AAA99805.1 |
Der f 3 | Der f 3.0101 | HASGGEKIQVAEIYQHENYDSMTID | Sequential / Linear | 86-110 | - | - | | - | - | Strongly reacting epitope | IgE specific assay | 25345157 | GenBank Protein: AAA99805.1 |
Der f 3 | Der f 3.0101 | LKTPMTLDQTNAKPVPLPPQGSDVKVG | Sequential / Linear | 118-144 | - | - | | - | - | Strongly reacting epitope | IgE specific assay | 25345157 | GenBank Protein: AAA99805.1 |
Der f 3 | Der f 3.0101 | QEGSYSLP | Sequential / Linear | 156-163 | - | - | | - | - | Strongly reacting epitope | IgE specific assay | 25345157 | GenBank Protein: AAA99805.1 |
Der f 3 | Der f 3.0101 | DVANGGVDSCQGDSGGPVVD | Sequential / Linear | 199-218 | - | - | | - | - | Strongly reacting epitope | IgE specific assay | 25345157 | GenBank Protein: AAA99805.1 |
Der f 4 | Der f 4.0101 | DIHTRSGDEQQFRR | Sequential / Linear | 92-105 | - | 558037 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | - |
Der f 4 | Der f 4.0101 | QSGLGTNGHH | Sequential / Linear | 130-139 | - | 558167 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | - |
Der f 4 | Der f 4.0101 | SHPFIYHE | Sequential / Linear | 248-255 | - | 558180 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | - |
Der f 4 | Der f 4.0101 | ITNVFRNN | Sequential / Linear | 284-291 | - | 558094 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | - |
Der f 4 | Der f 4.0101 | VGPPTDQHGNI | Sequential / Linear | 378-388 | - | 558201 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | - |
Der f 4 | Der f 4.0101 | VGHDEFDAFVAYHI | Sequential / Linear | 506-519 | - | 558200 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | - |
Der f 5 | - | KKEEQRVK | Sequential / Linear | 121-128 | - | 558100 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | - |
Der f 7 | Der f 7.0101 | SILDP | Sequential / Linear | 173-177 | 3UV1 | 150884 | IgE from serum of patients allergic to group 7 dust mite with bronchial asthma | - | - | - | Western / Immunoblot and Antigen Competition | 21820178 | - |
Der f 7 | - | MKVPDHAD | Sequential / Linear | 49-56 | 3UV1 | 558113 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | GenBank: FJ436108.1 |
Der f 7 | - | GELAMRNIEARGL | Sequential / Linear | 69-81 | 3UV1 | 558072 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | GenBank: FJ436108.1 |
Der f 7 | - | DLAYKLGD | Sequential / Linear | 117-124 | 3UV1 | 558039 | Pooled sera from pediatric patients with D. farinae hypersensitivity | - | - | - | Microarray | 27481284 | GenBank: FJ436108.1 |
Der p 2 | Der p 2.0101 | VPGIDPNACHYMKC | Sequential / Linear | 82-95 | 1A9V 1KTJ | 70304 | IgE from human antiserum | - | - | - | Radio Immuno Assay and Antigen Competition | 1720504 | Residue V1 is modified by Acetylation |
Der p 24 | Der p 24.0101 | MVHLTKTLRFINNPGFRKFYYGLQGYNKYGLY | Sequential / Linear | 1-32 | - | 913688 | Serum from House dust mite allergic patients | - | - | Immunodominant epitope | ELISA,Dot-blot | 31139345 | - |
Der p 5 | Der p 5.0101 | DRLMQRKDLDIFEQYNLEM | Sequential / Linear | 90-108 | 3MQ1 | 934949 | Allergic serum | - | - | - | ELISA, Alanine scanning | 30430936 | - |
Der p 5 | Der p 5.0102 | EDKKHDYQNEFDFLLMERIHEQIK | Sequential / Linear | 20-43 | - | 874187 | Rabbit IgG blocking antibody | - | - | - | ELISA | 30622713 | IgG epitope |
Der p 5 | Der p 5.0102 | IHEQIKKGELALFYLQEQ | Sequential / Linear | 38-55 | 3MQ1 | 874262 | Rabbit IgG blocking antibody | - | - | - | ELISA | 30622713 | IgG epitope |
Der p 5 | Der p 5.0102 | LMQRKDLDIFEQYNLEMAKKS | Sequential / Linear | 92-112 | 3MQ1 | - | Rabbit IgG blocking antibody and IgE | - | - | - | ELISA | 30622713 | IgG and IgE epitope |
Der p 7 | Der p 7.0101 | DPIHYDKITEEINKAVDEAVAAIEKSETFD | Sequential / Linear | 18-47 | 3H4Z | 969047 | IgE from serum of house dust mite allergic patients | - | - | - | Dot blot, antigen inhibition | 34220841 | - |
Equ c IgG3 | - | DVLFTWYVDGTEV | Sequential / Linear | 177-189 | - | 225719 | IgE from pooled serum of horse antivenom allergic patients | - | - | - | Western / Immunoblot | 24334152 | - |
Eri s HC | - | NSEVIQEAYTAQMTQTPSKIKSHFTGS | Sequential / Linear | 181-207 | - | 546744 | IgE from serum of Roe allergic patients | - | - | Immunodominant epitope | Western / Immunoblot | 27208437 | - |
Eri s HC | - | CADGKYPDNRPHGYPLDRR | Sequential / Linear | 644-662 | - | 546721 | IgE from serum of Roe allergic patients | - | - | - | Western / Immunoblot | 27208437 | - |
Eri s HC | - | FWWDDSHENHHIERKGENF | Sequential / Linear | 237-265 | - | 546728 | IgE from serum of Roe allergic patients | - | - | Immunodominant epitope | Western / Immunoblot | 27208437 | - |
Eri s HC | - | IRDAIAHGYITAKDGSTISI | Sequential / Linear | 331-350 | - | 546739 | IgE from serum of Roe allergic patients | - | - | - | Western / Immunoblot | 27208437 | - |
Eri s HC | - | GDVIESSTYSPNPQYYGAL | Sequential / Linear | 360-378 | - | 546731 | IgE from serum of Roe allergic patients | - | - | Immunodominant epitope | Western / Immunoblot | 27208437 | - |
Eri s HC | - | TAHVMLGRQGDPHGKFDLPPG | Sequential / Linear | 381-401 | - | 546752 | IgE from serum of Roe allergic patients | - | - | - | Western / Immunoblot | 27208437 | - |
Eri s HC | - | DNIFREHKDSLTPYTTQELE | Sequential / Linear | 423-442 | - | 546726 | IgE from serum of Roe allergic patients | - | - | - | Western / Immunoblot | 27208437 | - |
Eri s HC | - | VTNNNGKEVS | Sequential / Linear | 501-510 | - | 546758 | IgE from serum of Roe allergic patients | - | - | - | Western / Immunoblot | 27208437 | - |
Eri s HC | - | TVRAFAWPKYDNNGVEYSFNDGR | Sequential / Linear | 512-534 | - | 546756 | IgE from serum of Roe allergic patients | - | - | - | Western / Immunoblot | 27208437 | - |
Eri s HC | - | DGEEDATVDGLHDSTSFNHYG | Sequential / Linear | 623-643 | - | 546725 | IgE from serum of Roe allergic patients | - | - | - | Western / Immunoblot | 27208437 | - |
Exo m 1 | Exo m 1.0101 | VHNLQKRMQQLENDLDS | Sequential / Linear | 43-59 | - | 956741 | Sera from Shrimp allergic patients | - | - | - | Dot blot | 31707198 | - |
Exo m 1 | Exo m 1.0101 | VAALNRRIQLLEEDLERSEER | Sequential / Linear | 85-105 | - | 956737 | Sera from Shrimp allergic patients | - | - | - | Dot blot | 31707198 | - |
Exo m 1 | Exo m 1.0101 | ENRSLSDEERMDALENQLKEARFLAEEADRKYDE | Sequential / Linear | 131-164 | - | 956549 | Sera from Shrimp allergic patients | - | - | - | Dot blot | 31707198 | - |
Exo m 1 | Exo m 1.0101 | ESKIVELEEELRVVG | Sequential / Linear | 187-201 | - | 14183 | Sera from Shrimp allergic patients | - | - | - | Dot blot | 31707198 | - |
Exo m 1 | Exo m 1.0101 | ERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSE | Sequential / Linear | 243-280 | - | 956552 | Sera from Shrimp allergic patients | - | - | - | Dot blot | 31707198 | - |
Fag e 1 | - | QNVNRPSR | Sequential / Linear | 360-367 | - | 16452 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 15310064 | - |
Fag e 1 | - | KIRSEGGTIEVWDEE | Sequential / Linear | 44-58 | - | 111455 | IgE from serum of buckwheat allergic patients | - | - | Minor epitope | Western / Immunoblot | 19463732 | GenBank Protein: BAO50870.1 |
Fag e 1 | - | MRVTVQPDSLSLPSYYSSPRLV | Sequential / Linear | 70-91 | - | 111571 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 19463732 | GenBank Protein: BAO50870.1 |
Fag e 1 | - | DAHQPTRRVRKGDVVALP | Sequential / Linear | 136-153 | - | 111186 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 19463732 | GenBank Protein: BAO50870.1 |
Fag e 1 | - | QGGSKEGKSQKLNS | Sequential / Linear | 197-210 | - | 111669 | IgE from serum of buckwheat allergic patients | - | - | Minor epitope | Western / Immunoblot | 19463732 | GenBank Protein: BAO50870.1 |
Fag e 1 | - | ESDERGPIVKARKNMRQMVT | Sequential / Linear | 238-257 | - | 111260 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 19463732 | GenBank Protein: BAO50870.1 |
Fag e 1 | - | NMRFRHNLGPRTEADIASRQAGRIHSVD | Sequential / Linear | 278-306 | - | 111592 | IgE from serum of buckwheat allergic patients | - | - | Minor epitope | Western / Immunoblot | 19463732 | GenBank Protein: BAO50870.1 |
Fag e 1 | - | NAMLAPAWPLSGHRVFYVLRGEAQRQI | Sequential / Linear | 328-354 | - | 111576 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 19463732 | GenBank Protein: BAO50870.1 |
Fag e 1 | - | PQFYISTCRAGRD | Sequential / Linear | 376-388 | - | 111640 | IgE from serum of buckwheat allergic patients | - | - | Minor epitope | Western / Immunoblot | 19463732 | GenBank Protein: BAO50870.1 |
Fag e 1 | - | HASVFKGMPIPVLSNSYQISPR | Sequential / Linear | 409-430 | - | 111393 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 19463732 | GenBank Protein: BAO50870.1 |
Fag e 1 | - | QTRSHEHGLFSPFGGRS | Sequential / Linear | 447-453 | - | 111692 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 19463732 | GenBank Protein: BAO50870.1 |
Fag e 1 | - | NNLPILEF | Sequential / Linear | 384-391 | - | 10192 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 15310064 | - |
Fag e 1 | - | WNLNAH | Sequential / Linear | 411-416 | - | 21776 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 15310064 | - |
Fag e 1 | - | EGRSVF | Sequential / Linear | 434-439 | - | 18963 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 15310064 | - |
Fag e 1 | - | KAGNEG | Sequential / Linear | 460-465 | - | 5604 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 15310064 | - |
Fag e 1 | - | IAGKTSVLRA | Sequential / Linear | 482-491 | - | 25291 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 15310064 | - |
Fag e 1 | - | KEAFRL | Sequential / Linear | 506-511 | - | 8789 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 15310064 | - |
Fag e 1 | - | SRDEKERERF | Sequential / Linear | 526-535 | - | 60632 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 15310064 | - |
Fag e 1 | - | SSTMRARQCRLDQLTSSQ | Sequential / Linear | 23-40 | - | 111804 | IgE from serum of buckwheat allergic patients | - | - | Major epitope | Western / Immunoblot | 19463732 | GenBank Protein: BAO50870.1 |
Fag e 2 | Fag e 2.0101 | EGVRDLKE | Sequential / Linear | 99-106 | - | 138364 | IgE from serum of buckwheat-allergic patients | - | - | - | ELISA | 20407269 | - |
Fag t 1 | - | RAGRINTVNSNNLPILEFLQLSAQHVVLYKNAIIGPRWNLN | Sequential / Linear | 27-67 | - | 136587 | IgE from serum of buckwheat-allergic patients | - | - | - | ELISA | 20431913 | - |
Fel d 1 | Fel d 1.0101 | VAQYKALPVVLENA | Sequential / Linear | 47-60 | 1PUO 1ZKR 2EJN | 67729 | IgE from serum of Cat allergic patients | - | - | - | Radio Immunoassay | 7508463 | Epitope on Chain A |
Fel d 1 | Fel d 1.0101 | DAKMTEEDKENALS | Sequential / Linear | 68-81 | 1PUO 1ZKR 2EJN | 7562 | IgE from serum of Cat allergic patients | - | - | - | Radio Immunoassay | 7508463 | Epitope on Chain A |
Fel d 1 | Fel d 1.0101 | FAVANGNELLLDLS | Sequential / Linear | 32-45 | 1PUO 1ZKR 2EJN | 15295 | IgE from serum of Cat allergic patients | - | - | - | Radio Immunoassay | 7508463 | Epitope on Chain B |
Fel d 1 | Fel d 1.0101 | EICPAVKRDVDLFLTG | Sequential / Linear | 23-38 | 1PUO 1ZKR 2EJN | 12408 | Monoclonal antibody | - | - | - | Radio Immunoassay | 7687098 | Epitope on Chain A |
Fel d 1 | Fel d 1.0101 | LDKIYTSPLC | Sequential / Linear | 82-92 | 1PUO 1ZKR 2EJN | 37165 | Monoclonal antibody | - | - | - | Radio Immunoassay | 7687098 | Epitope on Chain A |
Fel d 1 | Fel d 1.0101 | VKMAETCPIFYDVF | Sequential / Linear | 18-31 | 1ZKR 2EJN | 69271 | Monoclonal antibody | - | - | - | Radio Immunoassay | 7687098 | Epitope on Chain B |
Fel d 1 | Fel d 1.0101 | KKIQDCYVENGLI | Sequential / Linear | 60-72 | 1PUO 1ZKR 2EJN | 31580 | Monoclonal antibody | - | - | - | Radio Immunoassay | 7687098 | Epitope on Chain A |
Fes e 1 | - | STFYGKPTGAGPK | Sequential / Linear | 23-35 | - | 61612 | Monoclonal antibody 24.64 | - | - | - | ELISA and Inhibition ELISA | 9314345 | - |
Gad c 1 | Gad c 1.0101 | VGLDAFSADELK | Sequential / Linear | 33-44 | - | - | IgE from serum of individuals allergic to codfish | - | - | - | Prausnitz-Küstner(PK) and radioallergosorbent(RAST) test | 6356964 | - |
Gad c 1 | Gad c 1.0101 | IADEDKEGFIEEDELK | Sequential / Linear | 49-64 | - | - | IgE from serum of individuals allergic to codfish | - | - | - | Prausnitz-Küstner(PK) and radioallergosorbent(RAST) test | 6356964 | - |
Gad c 1 | Gad c 1.0101 | LFLIAFAADL | Sequential / Linear | 65-74 | - | - | IgE from serum of individuals allergic to codfish | - | - | - | Prausnitz-Küstner(PK) and radioallergosorbent(RAST) test | 6356964 | - |
Gad c 1 | Gad c 1.0101 | AGDSDGDGKI | Sequential / Linear | 88-97 | - | - | IgE from serum of individuals allergic to codfish | - | - | - | Prausnitz-Küstner(PK) and radioallergosorbent(RAST) test | 6356964 | - |
Gad m 1 | Gad m 1.0101 | LKLFLQV | Sequential / Linear | 64-70 | - | - | Sera from healthy and fish allergic patients | - | - | - | ELISA | 30974223 | - |
Gad m 1 | Gad m 1.0201 | GDGKIGVDEFGAMIKA | Sequential / Linear | 94-109 | 2MBX | 189639 | Sera from fish-allergic patients with specific IgE to cod parvalbumin | - | - | Major epitope | ELISA | 23554100 | - |
Gal d 1 | Gal d 1.0101 | TDGVTYTNDCL | Sequential / Linear | 56-66 | - | 63164 | IgE from pooled serum of egg allergic patients | - | - | Major epitope | Western / Immunoblot | 11944924 | - |
Gal d 1 | Gal d 1.0101 | AEVDCSRFPN | Sequential / Linear | 25-34 | - | 114732 | IgE from serum of children with persistent egg allergy | - | - | Major epitope | Western / Immunoblot | 17573723 | Epitope in persistent egg allergy |
Gal d 1 | Gal d 1.0101 | ATDKEGKDVL | Sequential / Linear | 35-44 | - | 114749 | IgE from serum of children with persistent egg allergy | - | - | Major epitope | Western / Immunoblot | 17573723 | Epitope in persistent egg allergy |
Gal d 1 | Gal d 1.0101 | SIEFGTNISK | Sequential / Linear | 71-80 | - | 114948 | IgE from serum of children with persistent egg allergy | - | - | Major epitope | Western / Immunoblot | 17573723 | Epitope in persistent egg allergy |
Gal d 1 | Gal d 1.0101 | VEQGASVDKR | Sequential / Linear | 137-146 | - | 114972 | IgE from serum of children with persistent egg allergy | - | - | Major epitope | Western / Immunoblot | 17573723 | Epitope in persistent egg allergy |
Gal d 1 | Gal d 1.0101 | AEVDCSRFPNATDKEGKDVL | Sequential / Linear | 25-44 | - | 1209 | IgE from serum of egg allergic patients | - | - | - | Western / Immunoblot | 9257870 | - |
Gal d 1 | Gal d 1.0101 | EFGTNISK | Sequential / Linear | 73-80 | - | 12004 | IgE from serum of egg allergic patients | - | - | - | Western / Immunoblot | 9257870 | - |
Gal d 1 | Gal d 1.0101 | VLCNRAFNPVCG | Sequential / Linear | 109-120 | - | 69399 | IgE from serum of egg allergic patients | - | - | - | Western / Immunoblot | 9257870 | - |
Gal d 1 | Gal d 1.0101 | QGASVDKR | Sequential / Linear | 149-146 | - | 50833 | IgE from serum of egg allergic patients | - | - | - | Western / Immunoblot | 9257870 | - |
Gal d 1 | Gal d 1.0101 | NGTLTLSHFGKC | Sequential / Linear | 199-210 | - | 44083 | IgE from serum of egg allergic patients | - | - | - | Western / Immunoblot | 9257870 | - |
Gal d 1 | Gal d 1.0101 | SRFPNATDKEGK | Sequential / Linear | 30-41 | - | 1310201 | Patients sensitized to components rGal d 1, rGal d 3 | - | - | - | Microarray | 32909666 | - |
Gal d 1 | Gal d 1.0101 | DCLLCAYSIEF | Sequential / Linear | 64-74 | - | 7713 | IgE from pooled serum of egg allergic patients | - | - | Major epitope | Western / Immunoblot | 11944924 | - |
Gal d 1 | Gal d 1.0101 | KEGKDVLVCNKDL | Sequential / Linear | 39-50 | - | - | Patients sensitized to components rGal d 1, rGal d 3 | - | - | - | Microarray | 32909666 | - |
Gal d 1 | Gal d 1.0101 | GECKETVPMNCS | Sequential / Linear | 84-95 | - | 1310098 | Patients sensitized to components rGal d 1, rGal d 3 | - | - | - | Microarray | 32909666 | - |
Gal d 1 | Gal d 1.0101 | KEHDGECKETV | Sequential / Linear | 80-90 | - | 30424 | IgE from pooled serum of egg allergic patients | - | - | Major epitope | Western / Immunoblot | 11944924 | - |
Gal d 1 | Gal d 1.0101 | SSYAN | Sequential / Linear | 95-99 | - | 61478 | IgE from pooled serum of egg allergic patients | - | - | Major epitope | Western / Immunoblot | 11944924 | - |
Gal d 1 | Gal d 1.0101 | DGKVMVLCNRA | Sequential / Linear | 104-114 | - | 8431 | IgE from pooled serum of egg allergic patients | - | - | Major epitope | Western / Immunoblot | 11944924 | - |
Gal d 1 | Gal d 1.0101 | TYDNE | Sequential / Linear | 125-129 | - | 67323 | IgE from pooled serum of egg allergic patients | - | - | Major epitope | Western / Immunoblot | 11944924 | - |
Gal d 1 | Gal d 1.0101 | KRHDGGCRKE | Sequential / Linear | 145-154 | - | 33148 | IgE from pooled serum of egg allergic patients | - | - | Major epitope | Western / Immunoblot | 11944924 | - |
Gal d 1 | Gal d 1.0101 | KTYGNKCNFCNAVVES | Sequential / Linear | 183-198 | - | 33923 | IgE from pooled serum of egg allergic patients | - | - | Major epitope | Western / Immunoblot | 11944924 | - |
Gal d 1 | Gal d 1.0101 | TLSHFGKC | Sequential / Linear | 203-210 | - | 65102 | IgE from pooled serum of egg allergic patients | - | - | Major epitope | Western / Immunoblot | 11944924 | - |
Gal d 2 | Gal d 2.0101 | LAMVYLGAKDST | Sequential / Linear | 39-50 | 1JTI 1OVA 1UHG | 34879 | IgE from serum of patients allergic to egg white | - | - | Immunodominant epitope | Western / Immunoblot | 14600204 | - |
Gal d 2 | Gal d 2.0101 | ERKIKV | Sequential / Linear | 276-281 | 1JTI 1OVA 1UHG | 14009 | IgE from ovalbumin sensitized BALB/c mice | - | - | - | Western / Immunoblot | 17236828 | IgE epitope in a murine model |
Gal d 2 | Gal d 2.0101 | GITDVF | Sequential / Linear | 302-307 | 1JTI 1OVA 1UHG | 20453 | IgE from ovalbumin sensitized BALB/c mice | - | - | - | Western / Immunoblot | 17236828 | IgE epitope in a murine model |
Gal d 2 | Gal d 2.0101 | ISQAVHAAHA | Sequential / Linear | 324-333 | 1JTI 1OVA 1UHG | 28669 | IgE from ovalbumin sensitized BALB/c mice | - | - | - | Western / Immunoblot | 17236828 | IgE epitope in a murine model |
Gal d 2 | Gal d 2.0101 | AVLFFGRCVS | Sequential / Linear | 376-385 | 1JTI 1OVA 1UHG | 5429 | IgE from ovalbumin sensitized BALB/c mice | - | - | - | Western / Immunoblot | 17236828 | IgE epitope in a murine model |
Gal d 2 | Gal d 2.0101 | DVYSFSLA | Sequential / Linear | 96-103 | 1JTI 1OVA 1UHG | 10794 | IgE from serum of patients allergic to egg white | - | - | Immunodominant epitope | Western / Immunoblot | 14600204 | - |
Gal d 2 | Gal d 2.0101 | EDTQAMPFRV | Sequential / Linear | 192-201 | 1JTI 1OVA 1UHG | 11453 | IgE from serum of patients allergic to egg white | - | - | Immunodominant epitope | Western / Immunoblot | 14600204 | - |
Gal d 2 | Gal d 2.0101 | VLLPDE | Sequential / Linear | 244-249 | 1JTI 1OVA 1UHG | 69619 | IgE from serum of patients allergic to egg white | - | - | Immunodominant epitope | Western / Immunoblot | 14600204 | - |
Gal d 2 | Gal d 2.0101 | GLEQLESIIN | Sequential / Linear | 252-261 | - | 20825 | IgE from serum of patients allergic to egg white | - | - | Immunodominant epitope | Western / Immunoblot | 14600204 | 1JTI, 1OVA, 1UHG |
Gal d 2 | Gal d 2.0101 | INKVVRFD | Sequential / Linear | 54-61 | 1JTI 1OVA 1UHG | 27678 | IgE from ovalbumin sensitized BALB/c mice | - | - | - | Western / Immunoblot | 17236828 | IgE epitope in a murine model |
Gal d 2 | Gal d 2.0101 | VNVHSSLR | Sequential / Linear | 78-85 | 1JTI 1OVA 1UHG | 70213 | IgE from ovalbumin sensitized BALB/c mice | - | - | - | Western / Immunoblot | 17236828 | IgE epitope in a murine model |
Gal d 2 | Gal d 2.0101 | SRLYAE | Sequential / Linear | 104-109 | 1JTI 1OVA 1UHG | 60734 | IgE from ovalbumin sensitized BALB/c mice | - | - | - | Western / Immunoblot | 17236828 | IgE epitope in a murine model |
Gal d 2 | Gal d 2.0101 | GGLEPINFQT | Sequential / Linear | 128-137 | 1JTI 1OVA 1UHG | 19906 | IgE from ovalbumin sensitized BALB/c mice | - | - | - | Western / Immunoblot | 17236828 | IgE epitope in a murine model |
Gal d YGP40 | - | AEAPSAVLENLKARCSVSYNKIKTFNEVKF | Sequential / Linear | 1567-1596 | - | - | IgE from sera of YGP40-positive patients | - | - | - | Dot blot | 29669337 | - |
Gal d YGP40 | - | NYSMPANCYHILVQDCSSELKFLVMMK | Sequential / Linear | 1597-1623 | - | - | IgE from sera of YGP40-positive patients | - | - | - | Dot blot | 29669337 | - |
Gal d YGP40 | - | CAKGCSATKTTPVTVGFHCLPADSANSLTDK | Sequential / Linear | 1790-1820 | - | - | IgE from sera of YGP40-positive patients | - | - | - | Dot blot | 29669337 | - |
Gal d YGP40 | - | QMKYDQKSEDMQDTVDAHTTCSCENEECST | Sequential / Linear | 1821-1850 | - | - | IgE from sera of YGP40-positive patients | - | - | - | Dot blot | 29669337 | - |
Gly m 4 | Gly m 4.0101 | NVEG | Sequential / Linear | 43-46 | 2K7H | - | IgE from pooled serum of patients with soy allergy | - | - | - | Microarray, Phage Display | 27906504 | IgE-binding consensus motif |
Gly m 4 | Gly m 4.0101 | IDEA | Sequential / Linear | 74-77 | 2K7H | - | IgE from pooled serum of patients with soy allergy | - | - | - | Microarray, Phage Display | 27906504 | IgE-binding consensus motif |
Gly m 4 | Gly m 4.0101 | NLGYSY | Sequential / Linear | 78-83 | 2K7H | - | IgE from pooled serum of patients with soy allergy | - | - | - | Microarray, Phage Display | 27906504 | IgE-binding consensus motif |
Gly m 5 | Gly m 5.0101 | ECEEGEIPRPRPRPQHPEREPQQPGEKEE | Sequential / Linear | 5-33 | - | 181299 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | DPIYSNKLGKFFEITPEKNPQLRDLD | Sequential / Linear | 350-375 | - | 181292 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | QRESYFVDAQPKKKEEGNKGRKGPLSSILR | Sequential / Linear | 510-540 | - | 181434 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | LRRHKNKNPFLFGSNRFE | Sequential / Linear | 125-142 | - | - | Alpha casein-specific mAb 1D5 | - | - | - | Dot blot, MALDI-TOF MS | 28643898 | Bos d 9 cross-reactive epitope |
Gly m 5 | Gly m 5.0101 | KNPQLRDLDIFLSIVDMNE | Sequential / Linear | 367-385 | - | - | Alpha casein-specific mAb 1D5 | - | - | - | Dot blot, MALDI-TOF MS | 28643898 | Bos d 9 cross-reactive epitope |
Gly m 5 | Gly m 5.0101 | GNKGRKGPLSSILRAFY | Sequential / Linear | 527-543 | - | - | Alpha casein-specific mAb 1D5 | - | - | - | Dot blot, MALDI-TOF MS | 28643898 | Bos d 9 cross-reactive epitope |
Gly m 5 | Gly m 5.0101 | QLQNLRDYRILEFNSKPNT | Sequential / Linear | 164-182 | - | 1387227 | Sera from infants allergic to Cow Milk or mice mAbs | - | - | - | Western / Immunoblot | 32896409 | Bos d 9 IgE and IgG cross-reactive epitope |
Gly m 5 | Gly m 5.0101 | KEQIRALSKRAKSSSRKTISSED | Sequential / Linear | 319-341 | - | 1383331 | Sera from infants allergic to Cow Milk or mice mAbs | - | - | - | Western / Immunoblot | 32896409 | Bos d 9 IgE and IgG cross-reactive epitope |
Gly m 5 | Gly m 5.0101 | HEQREEQEWPRKEEKRGEKGSEEEDE | Sequential / Linear | 55-80 | - | 181334 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | QFPFPRPPHQKEERKQEEDEDEEQQR | Sequential / Linear | 90-115 | - | 181432 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | DEEQQRESEESEDSELRRHKNKNPFL | Sequential / Linear | 110-135 | - | 181288 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | NKNPFLFGSNRFETLFKNQYGRIRVLQRF | Sequential / Linear | 130-158 | - | 181406 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | TAILSLVNNDDRDSYRLQSGDALRVPSGT | Sequential / Linear | 200-229 | - | 181474 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | YYVVNPDNNENLRLITLAIPVNKPGRFES | Sequential / Linear | 230-260 | - | 181524 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | EQIRALSKRAKSSSRKTISSEDKPFN | Sequential / Linear | 320-345 | - | 181307 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | SEDKPFNLRSRDPIYSNKLGKFFEITPEKN | Sequential / Linear | 338-368 | - | 181455 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0301 | GRIRLLQRFNKRSPQLENLRDYR | Sequential / Linear | 51-73 | 1UIJ 1IPJ 1IPK | - | Sera from soybean allergic patients | - | - | - | ELISA | 32198043 | Also an IgG-binding epitope |
Gly m 5 | Gly m 5.0301 | LSRRAKSSSRKTISSEDEPFNLRSRNPIYS | Sequential / Linear | 221-250 | 1UIJ 1IPJ 1IPK | - | Sera from soybean allergic patients | - | - | - | ELISA | 32198043 | Also an IgG-binding epitope |
Gly m 6 | Gly m 6.0101 | GGSILSGFTLEFLEHAFSV | Sequential / Linear | 217-235 | 1FXZ 1UCX 1UD1 |
( ! ) Deprecated: Function split() is deprecated in C:\wamp\www\AllerBase\PHP_codes\BrSeqEpi.php on line 606 |
Call Stack |
# | Time | Memory | Function | Location |
1 | 0.0008 | 791440 | {main}( ) | ..\BrSeqEpi.php:0 |
20021 19632
| IgE from pooled serum of soy-allergic patient | - | - | - | Western / Immunoblot | 11146387 | Ara h 3 homologous epitope |
Gly m 6 | Gly m 6.0101 | GAIVTVKGGLSVI | Sequential / Linear | 253-265 | 1FXZ 1UCX 1UD1 | 18633 | IgE from pooled serum of soy-allergic patient | - | - | - | Western / Immunoblot | 11146387 | Ara h 3 homologous epitope |
Gly m 6 | Gly m 6.0201 | SGFAPEFLKEAFGVN | Sequential / Linear | 219-233 | - | 58026 | IgE from pooled serum of soybean and peanut-allergic patient | - | - | Immunodominant epitope | Western / Immunoblot and structural model | 12485602 | - |
Gly m 6 | Gly m 6.0201 | MFVPHYTLNANSIIY | Sequential / Linear | 358-372 | - | 41548 | IgE from serum of soybean allergic patients | - | - | - | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | NANSIIYALNGRALV | Sequential / Linear | 367-381 | - | 43262 | IgE from serum of soybean allergic patients | - | - | - | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | QHTFNLKSQQARQVK | Sequential / Linear | 469-475 | - | 51031 | IgE from serum of soybean allergic patients | - | - | Immunodominant epitope | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | AIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVE | Sequential / Linear | 251-286 | - | - | IgE from serum of allergic patients | - | - | Immunodominant epitope | ELISA | 36335553 | - |
Gly m 6 | Gly m 6.0201 | KLVLSLCFLLFSGCF | Sequential / Linear | 3-17 | - | 32233 | IgE from serum of soybean allergic patients | - | - | - | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | NGPQEIYIQQGNGIF | Sequential / Linear | 83-97 | - | 44051 | IgE from serum of soybean allergic patients | - | - | Immunodominant epitope | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | QQGNGIFGMIFPGCP | Sequential / Linear | 90-104 | - | 52031 | IgE from serum of soybean allergic patients | - | - | - | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | RFYLAGNQEQEFLKY | Sequential / Linear | 177-191 | - | 53810 | IgE from serum of soybean allergic patients | - | - | Immunodominant epitope | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | LKYQQQQQGGSQSQK | Sequential / Linear | 189-203 | - | 37068 | IgE from serum of soybean allergic patients | - | - | - | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | VKGGLRVTAPAMRKP | Sequential / Linear | 255-269 | - | 69226 | IgE from serum of soybean allergic patients | - | - | - | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | LDFPALWLLKLSAQY | Sequential / Linear | 337-351 | - | 35160 | IgE from serum of soybean allergic patients | - | - | - | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | LKLSAQYGSLRKNAM | Sequential / Linear | 345-359 | - | 36948 | IgE from serum of soybean allergic patients | - | - | Immunodominant epitope | Western / Immunoblot and structural model | 11112857 | - |
Gly m 8 | Gly m 8.0101 | NLNPCEHIMEKI | Sequential / Linear | 39-50 | - | 561714 | Serum from patients with peanut and soybean allergies | - | - | - | Microarray | 27187334 | GenBank Protein: AAD09630 |
Gly m 8 | Gly m 8.0101 | TMPGRINYIRKK | Sequential / Linear | 69-80 | - | 561782 | Serum from patients with peanut and soybean allergies | - | - | - | Microarray | 27187334 | GenBank Protein: AAD09630 |
Gly m 8 | Gly m 8.0101 | EEEEEGHMQKC | Sequential / Linear | 84-94 | - | 561645 | Serum from patients with peanut and soybean allergies | - | - | - | Microarray | 27187334 | GenBank Protein: AAD09630 |
Gly m 8 | Gly m 8.0101 | SELKSPICQCKA | Sequential / Linear | 99-110 | - | 561747 | Serum from patients with peanut and soybean allergies | - | - | - | Microarray | 27187334 | GenBank Protein: AAD09630 |
Gly m 8 | Gly m 8.0101 | CRKQLQGVNLTP | Sequential / Linear | 31-42 | - | 561628 | Serum from patients with peanut and soybean allergies | - | - | - | Microarray | 27187334 | GenBank Protein: AAD00178 |
Gly m 8 | Gly m 8.0101 | ILRTMRGRINYI | Sequential / Linear | 67-78 | - | 561682 | Serum from patients with peanut and soybean allergies | - | - | - | Microarray | 27187334 | GenBank Protein: AAD00178 |
Gly m 8 | Gly m 8.0101 | SELRSPKCQCKA | Sequential / Linear | 102-113 | - | 561749 | Serum from patients with peanut and soybean allergies | - | - | - | Microarray | 27187334 | GenBank Protein: AAD00178 |
Gly m 8 | Gly m 8.0101 | EKQKKKMEKELI | Sequential / Linear | 127-138 | - | 561656 | Serum from patients with peanut and soybean allergies | - | - | - | Microarray | 27187334 | GenBank Protein: AAD00178 |
Gly m Bd30K | - | FLVLLLFSLL | Sequential / Linear | 3-12 | - | 16955 | IgE from pooled serum from soybean-sensitive patients | - | - | Immunodominant epitope | Western / Immunoblot | 9751845 | - |
Gly m Bd30K | - | PQEFSKKYLQ | Sequential / Linear | 100-109 | - | 48988 | IgE from pooled serum from soybean-sensitive patients | - | - | Immunodominant epitope | Western / Immunoblot | 9751845 | - |
Gly m Bd30K | - | RCKANKIQDK | Sequential / Linear | 229-238 | - | 53282 | IgE from pooled serum from soybean-sensitive patients | - | - | Immunodominant epitope | Western / Immunoblot | 9751845 | - |
Gly m Bd30K | - | INHFVLLVGY | Sequential / Linear | 299-308 | - | 27650 | IgE from pooled serum from soybean-sensitive patients | - | - | Immunodominant epitope | Western / Immunoblot | 9751845 | - |
Gly m Bd30K | - | GYIWIQRNTG | Sequential / Linear | 331-340 | - | 23372 | IgE from pooled serum from soybean-sensitive patients | - | - | Immunodominant epitope | Western / Immunoblot | 9751845 | - |
Hali di Trp | - | AMKMEKENAVDRAEQ | Sequential / Linear | 10-24 | - | - | IgE from sera of abalone-sensitive patients | - | - | - | Dot blot, ELISA | 34881872 | - |
Hali di Trp | - | NEQKLRDTEEQKAKIEE | Sequential / Linear | 25-41 | - | - | IgE from sera of abalone-sensitive patients | - | - | - | Dot blot, ELISA | 34881872 | - |
Hali di Trp | - | QEAMAKLETSEKRVT | Sequential / Linear | 65-79 | - | - | IgE from sera of abalone-sensitive patients | - | - | - | Dot blot, ELISA | 34881872 | - |
Hali di Trp | - | AQLKEAKYIAED | Sequential / Linear | 146-157 | - | - | IgE from sera of abalone-sensitive patients | - | - | - | Dot blot, ELISA | 34881872 | - |
Hali di Trp | - | EAARKLAITEVDLER | Sequential / Linear | 164-178 | - | - | IgE from sera of abalone-sensitive patients | - | - | - | Dot blot, ELISA | 34881872 | - |
Hali di Trp | - | EAAEAKILELEEEL | Sequential / Linear | 184-197 | - | - | IgE from sera of abalone-sensitive patients | - | - | - | Dot blot, ELISA | 34881872 | - |
Hali di Trp | - | VVGNNMKSLEISEQ | Sequential / Linear | 199-212 | - | - | IgE from sera of abalone-sensitive patients | - | - | - | Dot blot, ELISA | 34881872 | - |
Hev b 1 | Hev b 1.0101 | FSNVYLFAKDKSGPLQPGV | Sequential / Linear | 32-50 | - | 17795 | IgE from serum of latex allergic patients | - | - | - | ELISA | 8732237 | - |
Hev b 1 | Hev b 1.0101 | IDRSLPPIVK | Sequential / Linear | 90-99 | - | 25664 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 1 | Hev b 1.0101 | KDASIQVVSA | Sequential / Linear | 99-108 | - | 30115 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 1 | Hev b 1.0101 | QPGVDIIEGPVKNVAVPLY | Sequential / Linear | 47-65 | - | 51847 | IgE from serum of latex allergic patients | - | - | - | ELISA and Antigen Competition | 8732237 | - |
Hev b 1 | Hev b 1.0101 | SLPGQTKILAKVFYGEN | Sequential / Linear | 122-138 | - | 59387 | IgE from serum of latex allergic patients | - | - | - | ELISA and Antigen Competition | 8732237 | - |
Hev b 1 | Hev b 1.0101 | AEDEDNQQGQ | Sequential / Linear | 2-11 | - | 849 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 1 | Hev b 1.0101 | KYLGFVQDAA | Sequential / Linear | 16-25 | - | 34502 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot and Antigen Competition | 11275264 | - |
Hev b 1 | Hev b 1.0101 | YLFAKDKSGP | Sequential / Linear | 36-45 | - | 74645 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 1 | Hev b 1.0101 | LQPGVDIIEG | Sequential / Linear | 46-55 | - | 38948 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot and Antigen Competition | 11275264 | - |
Hev b 1 | Hev b 1.0101 | AVPLYNRFSY | Sequential / Linear | 61-70 | - | 5502 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 1 | Hev b 1.0101 | YNRFSYIPNG | Sequential / Linear | 65-74 | - | 75209 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 13 | Hev b 13.0101 | AESFNLPYLSPYLSSLGSNFKH | Sequential / Linear | 82-103 | - | - | IgE from serum of latex-allergic patients | - | - | - | Western / Immunoblot | 19945164 | - |
Hev b 13 | Hev b 13.0101 | YSQFRQFIPRSQFIR | Sequential / Linear | 136-150 | - | - | IgE from serum of latex-allergic patients | - | - | - | Western / Immunoblot | 19945164 | - |
Hev b 13 | Hev b 13.0101 | LVNSFSANVKKIYDLGARTFWI | Sequential / Linear | 199-220 | - | - | IgE from serum of latex-allergic patients | - | - | - | Western / Immunoblot | 19945164 | - |
Hev b 13 | Hev b 13.0101 | LTYFPWAEKDSA | Sequential / Linear | 233-244 | - | - | IgE from serum of latex-allergic patients | - | - | - | Western / Immunoblot | 19945164 | - |
Hev b 13 | Hev b 13.0101 | QHFNH | Sequential / Linear | 255-259 | - | - | IgE from serum of latex-allergic patients | - | - | - | Western / Immunoblot | 19945164 | - |
Hev b 13 | Hev b 13.0101 | VAQLRKDLPLATFV | Sequential / Linear | 265-278 | - | - | IgE from serum of latex-allergic patients | - | - | - | Western / Immunoblot | 19945164 | - |
Hev b 13 | Hev b 13.0101 | VKYSLFSE | Sequential / Linear | 285-292 | - | - | IgE from serum of latex-allergic patients | - | - | - | Western / Immunoblot | 19945164 | - |
Hev b 13 | Hev b 13.0101 | FPLITCCG | Sequential / Linear | 300-307 | - | - | IgE from serum of latex-allergic patients | - | - | - | Western / Immunoblot | 19945164 | - |
Hev b 2 | Hev b 2.0101 | VSEVIALYKKSNITRMRIYDPNRA | Sequential / Linear | 52-75 | 4HPG 4IIS | 111923 | IgE from serum of latex allergic patients | - | - | - | Western / Immunoblot | 19185347 | - |
Hev b 2 | Hev b 2.0101 | TNPSNAKSWVQKNVRGFWSSVLFR | Sequential / Linear | 100-123 | - | 111839 | IgE from serum of latex allergic patients | - | - | - | Western / Immunoblot | 19185347 | - |
Hev b 2 | Hev b 2.0101 | AWLAQFVLP | Sequential / Linear | 139-147 | 4HPG 4IIS | 111135 | IgE from serum of latex allergic patients | - | - | - | Western / Immunoblot | 19185347 | - |
Hev b 2 | Hev b 2.0101 | DQIKVSTAIDLT | Sequential / Linear | 163-174 | 4HPG 4IIS | 111212 | IgE from serum of latex allergic patients | - | - | - | Western / Immunoblot | 19185347 | - |
Hev b 2 | Hev b 2.0101 | DPIIGFLSSIRSPLL | Sequential / Linear | 196-210 | 4HPG 4IIS | 111209 | IgE from serum of latex allergic patients | - | - | - | Western / Immunoblot | 19185347 | - |
Hev b 2 | Hev b 2.0101 | WDGQRGYKNLFDATLDAL | Sequential / Linear | 241-258 | 4HPG 4IIS | 111945 | IgE from serum of latex allergic patients | - | - | - | Western / Immunoblot | 19185347 | - |
Hev b 2 | Hev b 2.0101 | NLIQHVKGGTPKRPN | Sequential / Linear | 298-312 | - | 111588 | IgE from serum of latex allergic patients | - | - | - | Western / Immunoblot | 19185347 | - |
Hev b 2 | Hev b 2.0101 | GLFFPDKRPKYNLNF | Sequential / Linear | 337-351 | - | 111347 | IgE from serum of latex allergic patients | - | - | - | Western / Immunoblot | 19185347 | - |
Hev b 2 | Hev b 2.0101 | TEHNATILFLKSDM | Sequential / Linear | 361-374 | - | 111822 | IgE from serum of latex allergic patients | - | - | - | Western / Immunoblot | 19185347 | - |
Hev b 3 | Hev b 3.0101 | AEEVEEERLK | Sequential / Linear | 2-11 | - | 893 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 3 | Hev b 3.0101 | VPTAVYFSEK | Sequential / Linear | 159-168 | - | 70490 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 3 | Hev b 3.0101 | QGYRVSSYLP | Sequential / Linear | 179-188 | - | 50990 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 3 | Hev b 3.0101 | ERLKYLDFVR | Sequential / Linear | 8-17 | - | 14028 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 3 | Hev b 3.0101 | TLYLYAKDIS | Sequential / Linear | 29-38 | - | 65160 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 3 | Hev b 3.0101 | LKPGVDTIEN | Sequential / Linear | 41-50 | - | 36988 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 3 | Hev b 3.0101 | YYIPLEAVKFV | Sequential / Linear | 60-70 | - | 76523 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot and Antigen Competition | 11275264 | - |
Hev b 3 | Hev b 3.0101 | VPPVIKQVSA | Sequential / Linear | 85-94 | - | 70439 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 3 | Hev b 3.0101 | APRIVLDVAS | Sequential / Linear | 103-112 | - | 3780 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 3 | Hev b 3.0101 | GVQEGAKALY | Sequential / Linear | 118-127 | - | 23107 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 3 | Hev b 3.0101 | AVITWRALNK | Sequential / Linear | 138-147 | - | 5391 | IgE from serum of latex allergic patients with spina bifida | - | - | Immunodominant epitope | Western / Immunoblot | 11275264 | - |
Hev b 5 | Hev b 5.0101 | KNETPEVT | Sequential / Linear | 15-22 | - | 98174 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 10359901 | - |
Hev b 5 | Hev b 5.0101 | PITEAAET | Sequential / Linear | 132-139 | - | 78242 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 10359901 | - |
Hev b 5 | Hev b 5.0101 | TEVPVEKT | Sequential / Linear | 142-149 | - | 78276 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 11398087 | - |
Hev b 5 | Hev b 5.0101 | TKTEEPAA | Sequential / Linear | 27-34 | - | 78137 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 11398087 | - |
Hev b 5 | Hev b 5.0101 | APPASEQET | Sequential / Linear | 34-42 | - | 78104 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 11398087 | - |
Hev b 5 | Hev b 5.0101 | EEPTAAPAEP | Sequential / Linear | 50-59 | - | 78142 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 11398087 | - |
Hev b 5 | Hev b 5.0101 | EKAEEVEK | Sequential / Linear | 67-74 | - | 78141 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 11398087 | - |
Hev b 5 | Hev b 5.0101 | IEKTEEPA | Sequential / Linear | 75-82 | - | 78143 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 11398087 | - |
Hev b 5 | Hev b 5.0101 | DQTTPEEKPAEPE | Sequential / Linear | 86-98 | - | 78255 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 11398087 | - |
Hev b 5 | Hev b 5.0101 | EEPKHETK | Sequential / Linear | 103-111 | - | 78136 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 11398087 | - |
Hev b 5 | Hev b 5.0101 | EKPAEEEKP | Sequential / Linear | 124-132 | - | 78145 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 11398087 | - |
Hev b 6 | Hev b 6.01 | PNNLCCSQWGWC | Sequential / Linear | 30-41 | 1Q9B 1T0W 4WP4 1WKX 1HEV | 95674 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 9097919 | - |
Hev b 6 | Hev b 6.01 | EYCSPDHN | Sequential / Linear | 46-53 | 1Q9B 4WP4 1WKX 1HEV | 95371 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 9097919 | - |
Hev b 6 | Hev b 6.01 | LYNSQDHG | Sequential / Linear | 79-85 | - | 95583 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 9097919 | - |
Hev b 6 | Hev b 6.01 | AASAYCST | Sequential / Linear | 91-98 | - | 95201 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 9097919 | - |
Hev b 6 | Hev b 6.01 | CSNGGL | Sequential / Linear | 151-156 | - | 95294 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 9097919 | - |
Hev b 6 | Hev b 6.01 | NYQFVDCG | Sequential / Linear | 181-188 | - | 95644 | IgE from serum of latex allergic subjects | - | - | - | Western / Immunoblot | 9097919 | - |
Hol l 1 | Hol l 1.0101 | IAKVPPGPNITATYGDEWLDAKSTWYG | Sequential / Linear | 26-52 | - | 25330 | IgE from serum of velvet grass pollen-allergic patients | - | - | - | Western / Immunoblot | 9215246 | - |
Hol l 1 | Hol l 1.0101 | PIFKDGRGCGSCFEIK | Sequential / Linear | 86-101 | - | 47895 | IgE from serum of velvet grass pollen-allergic patients | - | - | - | Western / Immunoblot | 9215246 | - |
Hol l 1 | Hol l 1.0101 | SGEPVTVHITDDNEEPIAPYHF | Sequential / Linear | 109-130 | - | 58020 | IgE from serum of velvet grass pollen-allergic patients | - | - | - | Western / Immunoblot | 9215246 | - |
Jug r 1 | Jug r 1.0101 | QGLRGEEMEEMV | Sequential / Linear | 104-115 | - | 50901 | IgE from serum of walnut allergic patients | - | - | - | Western / Immunoblot and Antigen Competition | 11799381 | - |
Jug r 1 | Jug r 1.0101 | FRTTITTMEIDEDID | Sequential / Linear | 16-30 | - | - | IgE from serum of Chinese walnut allergic patients | - | - | - | Western / Immunoblot | 32283362 | - |
Jug r 1 | Jug r 1.0101 | CGISSQRCEIRRSWF | Sequential / Linear | 125-139 | - | - | IgE from serum of Chinese walnut allergic patients | - | - | - | Western / Immunoblot | 32283362 | - |
Jug r 2 | Jug r 2.0101 | DQRSQEERER | Sequential / Linear | 49-58 | - | 157171 | IgE from Walnut-allergic patients | - | - | - | Western / Immunoblot | 21883278 | - |
Jug r 2 | Jug r 2.0101 | YEQCQQQCER | Sequential / Linear | 76-85 | 7LVG | 158509 | IgE from Walnut-allergic patients | - | - | - | Western / Immunoblot | 21883278 | - |
Jug r 2 | Jug r 2.0101 | QRQCQQRCER | Sequential / Linear | 140-149 | 7LVE | 157811 | IgE from Walnut-allergic patients | - | - | - | Western / Immunoblot | 21883278 | - |
Jug r 2 | Jug r 2.0101 | QNNIINQLER | Sequential / Linear | 532-541 | - | 157802 | IgE from Walnut-allergic patients | - | - | - | Western / Immunoblot | 21883278 | - |
Jug r 4 | Jug r 4.0101 | MAKPILLSIYLFLIV | Sequential / Linear | 1-15 | - | 114468 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | LATAFQIPREDARRL | Sequential / Linear | 465-479 | - | 114442 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | IESWDPNNQQFQCAG | Sequential / Linear | 57-71 | - | 114404 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | YSNAPQLVYIARGRG | Sequential / Linear | 89-103 | - | 114695 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | RQSQQGQSREFQQDR | Sequential / Linear | 121-135 | - | 114590 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | REFQQDRHQKIRHFR | Sequential / Linear | 129-143 | - | 114569 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | GDIIAFPAGVAHWSY | Sequential / Linear | 145-159 | - | 114351 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | QGQQEYEQHRRQQQR | Sequential / Linear | 201-215 | - | 114531 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | HRRQQQRQQRPGEHG | Sequential / Linear | 209-223 | - | 114396 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | QLQVIRPRWSREEQE | Sequential / Linear | 273-287 | - | 114543 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | PHWNLNAHSVVYALR | Sequential / Linear | 377-391 | - | 114508 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | TGVLFPGCPETFEES | Sequential / Linear | 105-119 | - | 114627 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | SVVYALRGRAEVQVV | Sequential / Linear | 385-399 | - | 114620 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | FNRQESTLVRSRPSR | Sequential / Linear | 481-495 | - | 114339 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | VRSRPSRSRSSRSER | Sequential / Linear | 489-503 | - | 114666 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | VFSGFDADFLADAFN | Sequential / Linear | 233-247 | - | 114650 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | QSENDHRRSIVRVEG | Sequential / Linear | 257-271 | - | 114555 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | SIVRVEGRQLQVIRP | Sequential / Linear | 265-279 | - | 114610 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | WSREEQEREERKERE | Sequential / Linear | 281-295 | - | 114676 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | DDNGLEETICTLRLR | Sequential / Linear | 313-327 | - | 114293 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | LTIPQNFAVVKRARN | Sequential / Linear | 417-431 | - | 114462 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 19631385 | - |
Jug r 4 | Jug r 4.0101 | VVKRARNEGFEWVSF | Sequential / Linear | 425-439 | - | 114671 | IgE from pooled serum of walnut and hazelnut allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 19631385 | - |
Jun a 1 | Jun a 1.0101 | IFSQNMNIKLKMP | Sequential / Linear | 92-104 | 1PXZ | 26167 | IgE from serum of cedar pollen allergic patients | - | - | Major epitope | Western / Immunoblot | 14563374 | - |
Jun a 1 | Jun a 1.0101 | AFNQFGPNAGQR | Sequential / Linear | 239-250 | 1PXZ | 66935 | IgE from serum of cedar pollen allergic patients | - | - | Major epitope | Western / Immunoblot | 14563374 | - |
Jun a 1 | Jun a 1.0101 | MPRARYGL | Sequential / Linear | 251-258 | 1PXZ | 42310 | IgE from serum of cedar pollen allergic patients | - | - | Major epitope | Western / Immunoblot | 14563374 | - |
Jun a 1 | Jun a 1.0101 | WRSTRDAFING | Sequential / Linear | 317-327 | 1PXZ | 73051 | IgE from serum of cedar pollen allergic patients | - | - | Minor epitope | Western / Immunoblot | 14563374 | - |
Jun a 3 | Jun a 3.0101 | ADINAVCPSELK | Sequential / Linear | 146-157 | 7P20 | 687 | IgE from serum of cedar hypersensitive patients | - | - | - | Western / Immunoblot | 10969020 | - |
Jun a 3 | Jun a 3.0101 | VDGGCNSACNVFK | Sequential / Linear | 158-170 | 7P20 | 67957 | IgE from serum of cedar hypersensitive patients | - | - | - | Western / Immunoblot | 10969020 | - |
Jun a 3 | Jun a 3.0101 | NAYVDNCPATNYSK | Sequential / Linear | 178-191 | - | 43356 | IgE from serum of cedar hypersensitive patients | - | - | - | Western / Immunoblot | 10969020 | - |
Lat c 1 | Lat c 1.0101 | MAFAGILNEADITAALAACQAADSF | Sequential / Linear | 1-25 | - | - | IgE from serum of fish allergic patients | - | - | - | ELISA | 33423763 | - |
Lat c 1 | Lat c 1.0101 | AACQAADSFKHKDFFVKVGLAGKSD | Sequential / Linear | 17-41 | - | - | IgE from serum of fish allergic patients | - | - | - | ELISA | 33423763 | - |
Lat c 1 | Lat c 1.0101 | EFLKAGDSDGDGKIGVDEFAALVKV | Sequential / Linear | 85-109 | - | - | IgE from serum of fish allergic patients | - | - | - | ELISA | 33423763 | - |
Len c 1 | Len c 1.0101 | EEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAIN | Sequential / Linear | 313-348 | - | 141631 | IgE from serum of Lentil allergic patients | - | - | - | Fluorescence immuno assay | 20816193 | - |
Len c 1 | Len c 1.0101 | PAGHPVAINASSDLNLIGFGINAKNNQ | Sequential / Linear | 340-366 | 7U1H | 141721 | IgE from serum of Lentil allergic patients | - | - | - | Fluorescence immuno assay | 20816193 | - |
Len c 1 | Len c 1.0101 | LIGFGINAKNNQRNFLAGEEDNVIS | Sequential / Linear | 355-379 | 7U1H | 141700 | IgE from serum of Lentil allergic patients | - | - | - | Fluorescence immuno assay | 20816193 | - |
Len c 1 | Len c 1.0101 | EEDNVISQIQRPVKELAFPGSSREVDR | Sequential / Linear | 373-399 | 7U1H | 141628 | IgE from serum of Lentil allergic patients | - | - | - | Fluorescence immuno assay | 20816193 | - |
Len c LcA | - | TETTSFSITKFSPDQ | Sequential / Linear | 31-45 | 1LEM 1LEN 1LES 2LAL | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Len c LcA | - | GDGYTTKGKLTLTKAVKSTVGRAL | Sequential / Linear | 52-75 | 1LEM 1LEN 1LES 2LAL | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Len c LcA | - | PIH | Sequential / Linear | 79-81 | 1LEM 1LEN 1LES 2LAL | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Len c LcA | - | VADEFTFFI | Sequential / Linear | 109-117 | - | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Len c LcA | - | YLGVFNSKEYDK | Sequential / Linear | 130-141 | 1LEM 1LEN 1LES 2LAL | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Len c LcA | - | PSN | Sequential / Linear | 160-162 | 1LEM 1LEN 1LES 2LAL | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Len c LcA | - | HIGIDVNSIKSVNTKSWNLQNGERANV | Sequential / Linear | 166-192 | 1LEM 1LEN 1LES 2LAL | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Len c LcA | - | LKDVVPEWVRIG | Sequential / Linear | 229-240 | - | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Len c LcA | - | AAHEVHSWSFHSELGGTSSS | Sequential / Linear | 250-269 | - | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Lit v 1 | Lit v 1.0101 | MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRA | Sequential / Linear | 1-36 | - | 41215 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 1 | Lit v 1.0101 | QKRMQQLENDLDQVQ | Sequential / Linear | 47-61 | - | 1087239 | IgE from serum of Shrimp allergic patients | - | - | - | Dot blot, ELISA, Mediator release | 32334299 | - |
Lit v 1 | Lit v 1.0101 | EDLERSEERLNT | Sequential / Linear | 97-108 | - | 1087203 | IgE from serum of Shrimp allergic patients | - | - | - | Dot blot, ELISA, Mediator release | 32334299 | - |
Lit v 1 | Lit v 1.0101 | RSVQKLQKEVDRLE | Sequential / Linear | 244-257 | - | 1087243 | IgE from serum of Shrimp allergic patients | - | - | - | Dot blot, ELISA, Mediator release | 32334299 | - |
Lit v 1 | Lit v 1.0101 | EKSEEEVHNLQKRMQQLENDLDQVQES | Sequential / Linear | 37-63 | - | 12871 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 1 | Lit v 1.0101 | QESLLKANIQLVEKDKALSNA | Sequential / Linear | 61-81 | - | 50696 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 1 | Lit v 1.0101 | EGEVAALNRRIQLLEEDLERSEER | Sequential / Linear | 82-105 | - | 116700 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 1 | Lit v 1.0101 | ASQAADESERMRKVLENRSLSDEERMDALENQLKE | Sequential / Linear | 115-150 | - | 11190 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 1 | Lit v 1.0101 | ALENQLKEARFLAEEADRKY | Sequential / Linear | 142-162 | - | 116689 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 1 | Lit v 1.0101 | EADRKYDEVARKLAMVEADLERAEERA | Sequential / Linear | 157-183 | - | 11011 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 1 | Lit v 1.0101 | IVELEEELRVVGNNLKSLEVS | Sequential / Linear | 190-210 | - | 116755 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 1 | Lit v 1.0101 | VQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY | Sequential / Linear | 246-284 | - | 116824 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 13 | Lit v 13.0101 | VEITKDGDTYTMKTTTTFKTTEIKFKLGEEFEETTADGRVVKSTIT | Sequential / Linear | 40-85 | - | 1642076 | Sera from shrimp-allergic patients | - | - | - | ELISA | 34695231 | - |
Lit v 13 | Lit v 13.0101 | ELLREFTDDKMLMECKVDDVVCKRVYSRLE | Sequential / Linear | 107-136 | - | - | Sera from shrimp-allergic patients | - | - | - | ELISA | 34695231 | - |
Lit v 13 | Lit v 13.0101 | TTTTFKTTEIKFKLGEEFEE | Sequential / Linear | 53-72 | - | - | Sera from shrimp allergic patients sensitized to FABP | - | - | - | ELISA | DOI:10.22541/au.161857969.92060255/v1 | Epitope mediating cross-reactivity with Blo t 13 |
Lit v 2 | Lit v 2.0101 | MADAAVIEKLEAGFKKLE | Sequential / Linear | 1-18 | 4BG4 4BHL | 179235 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 2 | Lit v 2.0101 | SLLKKYLTKEVFDKLKDK | Sequential / Linear | 25-42 | 4AM1 4BG4 4BHL | 179503 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 2 | Lit v 2.0101 | GVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQT | Sequential / Linear | 64-96 | 4AM1 4BG4 4BHL | 178951 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 2 | Lit v 2.0101 | ISTRVRCGRSLQGYPFNPCLT | Sequential / Linear | 121-141 | 4BG4 4BHL | 179042 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 2 | Lit v 2.0101 | ESQYKEMEAKVSSTLSSL | Sequential / Linear | 142-159 | 4AM1 4BG4 4BHL | 178775 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 2 | Lit v 2.0101 | EGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGD | Sequential / Linear | 160-192 | 4AM1 4BG4 4BHL | 178730 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 2 | Lit v 2.0101 | SMQMGGDLGQVFRRLTSAVNEIEK | Sequential / Linear | 232-255 | 4AM1 4BG4 4BHL | 179513 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 2 | Lit v 2.0101 | EGGIYDISNKRRMGLTEFQAVKEM | Sequential / Linear | 319-342 | 4BG4 | 178732 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 3 | Lit v 3.0101 | RSKKSGGGSNVFDMFTQR | Sequential / Linear | 13-30 | - | 179456 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 3 | Lit v 3.0101 | VFDMFTQRQVAEFKEGFQLMDRDKDG | Sequential / Linear | 22-48 | - | 179323 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 3 | Lit v 3.0101 | VIGKTDLRGTFDEIGRIA | Sequential / Linear | 49-66 | - | 179629 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 3 | Lit v 3.0101 | TFDEIGRIATDQELDEMLADAPAPINFTMLLNM | Sequential / Linear | 58-90 | - | 179562 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 3 | Lit v 3.0101 | PAPINFTMLLNMFAERQTGES | Sequential / Linear | 79-99 | - | - | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 3 | Lit v 3.0101 | NIDCDTFRHALMTWGDKFSSQEAD | Sequential / Linear | 118-141 | - | 179301 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 4 | Lit v 4.0101 | KYVVRYMYDIDNNGFLDKNDFECLAVR | Sequential / Linear | 10-36 | - | 179110 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 4 | Lit v 4.0101 | DAYANNQKIMRNLWNEIAELADFN | Sequential / Linear | 49-72 | - | 178640 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lit v 4 | Lit v 4.0101 | CITRSAFAEVKEIDDAYN | Sequential / Linear | 130-147 | - | 179453 | IgE from serum of Shrimp allergic patients | - | - | - | Microarray | 20471069 | - |
Lol p 5 | Lol p 5.0102 | AANAPPADKFKI | Sequential / Linear | 74-85 | - | 315 | IgE from serum of spring hay fever patient | - | - | Strongly binding epitope | Dot–blot Immunoassay | 9747889 | - |
Lol p 5 | Lol p 5.0102 | GAATAAAGGYKA | Sequential / Linear | | - | 18529 | IgE from serum of spring hay fever patient | - | - | Strongly binding epitope | Dot–blot Immunoassay | 9747889 | - |
Mal d 3 | Mal d 3.0101 | YVRSGGAVP | Sequential / Linear | 40-48 | - | 23494 | IgE from pooled serum of patients allergic to Rosaceae fruits | - | - | - | Western / Immunoblot | 18036340 | - |
Mal d 3 | Mal d 3.0101 | INGLARTTADRQTACNCL | Sequential / Linear | 58-75 | - | 64391 | IgE from pooled serum of patients allergic to Rosaceae fruits | - | - | - | Western / Immunoblot | 18036340 | - |
Mal d 3 | Mal d 3.0101 | NNA | Sequential / Linear | 88-90 | - | - | IgE from pooled serum of patients allergic to Rosaceae fruits | - | - | - | Western / Immunoblot | 18036340 | - |
Mal d 3 | Mal d 3.0101 | NVPYKISTS | Sequential / Linear | 100-108 | - | 70216 | IgE from pooled serum of patients allergic to Rosaceae fruits | - | - | - | Western / Immunoblot | 18036340 | - |
Met e 1 | Met e 1.0101 | EEVHNLQKRMQQLENDLDQV | Sequential / Linear | 31-50 | - | - | IgE from sera of patients with shrimp allergy | - | - | - | ELISA, Dot-blot | 25365343 | - |
Met e 1 | Met e 1.0101 | NQLKEARFLAEEADRKYDEV | Sequential / Linear | 136-155 | - | - | IgE from sera of patients with shrimp allergy | - | - | - | ELISA, Dot-blot | 25365343 | - |
Met e 1 | Met e 1.0101 | EARAEFAERSVQKLQKEVDR | Sequential / Linear | 226-245 | - | - | IgE from sera of patients with shrimp allergy | - | - | - | ELISA, Dot-blot | 25365343 | - |
Mus a 5 | Mus a 5.0102 | SEVVSLYKSNNIARMRLYDPNQAA | Sequential / Linear | 44-67 | 2CYG | 111768 | IgE from serum of latex allergic patients | - | - | - | Western / Immunoblot | 19185347 | Cross-reactive epitope of Hev b 2.0101 |
Mus a 5 | Mus a 5.0102 | SAAGDWIRRNVVAYW | Sequential / Linear | 95-109 | 2CYG | 111752 | IgE from serum of latex allergic patients | - | - | - | Western / Immunoblot | 19185347 | Cross-reactive epitope of Hev b 2.0101 |
Mus a 5 | Mus a 5.0102 | MRNIYNALSSAG | Sequential / Linear | 137-148 | 2CYG | 111568 | IgE from serum of latex allergic patients | - | - | - | Western / Immunoblot | 19185347 | Cross-reactive epitope of Hev b 2.0101 |
Mus a 5 | Mus a 5.0102 | NLIRHVGGGTPR | Sequential / Linear | 287-298 | 2CYG | 111589 | IgE from serum of latex allergic patients | - | - | - | Western / Immunoblot | 19185347 | Cross-reactive epitope of Hev b 2.0101 |
Mus a 5 | Mus a 5.0102 | GLFYPNKQP | Sequential / Linear | 326-334 | 2CYG | 111348 | IgE from serum of latex allergic patients | - | - | - | Western / Immunoblot | 19185347 | Cross-reactive epitope of Hev b 2.0101 |
Myr p 1 | Myr p 1.0101 | KEAIPMAVEMAKSQ | Sequential / Linear | 93-106 | - | 30292 | IgE from serum of ant venom-allergic patients | - | - | - | Antigen Competition | 7508264 | - |
Nic t Osmotin | Nic t Osmotin | APRGTKMARVWGRT | Sequential / Linear | 57-70 | 1PCV | - | IgE from serum of patients with allergic rhinitis and asthma | - | - | - | ELISA | 23349964 | - |
Nic t Osmotin | Nic t Osmotin | CNFNAAGRGTCQTG | Sequential / Linear | 72-85 | 1PCV | - | IgE from serum of patients with allergic rhinitis and asthma | - | - | - | ELISA | 23349964 | - |
Nic t Osmotin | Nic t Osmotin | TANINGECPRELRVPGGCN | Sequential / Linear | 147-165 | 1PCV | - | IgE from serum of patients with allergic rhinitis and asthma | - | - | - | ELISA | 23349964 | - |
Oct v 1 | - | RVGECESEIAGLNRRIQLLEEDLERSEERLSTAQTK | Sequential / Linear | 77-112 | - | - | IgE from serum of patients allergic to crustaceans and mollusks | - | - | - | ELISA | DOI:10.1046/j.1444-2906.2001.00344.x | - |
Oct v 1 | - | QLEEAKWIAEDAD | Sequential / Linear | 147-159 | - | - | IgE from serum of patients allergic to crustaceans and mollusks | - | - | - | ELISA | DOI:10.1046/j.1444-2906.2001.00344.x | - |
Oct v 1 | - | AISDELDQTFAEL | Sequential / Linear | 269-281 | - | - | IgE from serum of patients allergic to crustaceans and mollusks | - | - | - | ELISA | DOI:10.1046/j.1444-2906.2001.00344.x | - |
Ole e 9 | Ole e 9.0101 | ATPTPT | Sequential / Linear | 360-365 | 2JON | 99909 | IgE from serum of patients allergic to O. europaea pollen extract | - | - | - | Western / Immunoblot | 18096638 | - |
Ole e 9 | Ole e 9.0101 | WCVPKPGVSD | Sequential / Linear | 372-381 | 2JON | 100639 | IgE from serum of patients allergic to O. europaea pollen extract | - | - | - | Western / Immunoblot | 18096638 | - |
Ole e 9 | Ole e 9.0101 | PIQPGGACFE | Sequential / Linear | 400-409 | 2JON | 100380 | IgE from serum of patients allergic to O. europaea pollen extract | - | - | - | Western / Immunoblot | 18096638 | - |
Ole e 9 | Ole e 9.0101 | RNSWNCD | Sequential / Linear | 430-436 | 2JON | 100479 | IgE from serum of patients allergic to O. europaea pollen extract | - | - | - | Western / Immunoblot | 18096638 | - |
Par j 1 | Par j 1.0101 | QGKEKEP | Sequential / Linear | 19-25 | - | 106977 | IgE from serum of P judaica-allergic patients | - | - | - | Western / Immunoblot | 12680870 | - |
Par j 1 | Par j 1.0101 | SKGCCSGAKRLDG | Sequential / Linear | 26-37 | - | 106846 | IgE from serum of P judaica-allergic patients | - | - | - | Western / Immunoblot | 12680870 | - |
Par j 1 | Par j 1.0101 | KTGPQRV | Sequential / Linear | 41-47 | - | 106578 | IgE from serum of P judaica-allergic patients | - | - | - | Western / Immunoblot | 12680870 | - |
Par j 1 | Par j 1.0101 | PKHCGIVD | Sequential / Linear | 72-79 | - | 106407 | IgE from serum of P judaica-allergic patients | - | - | - | Western / Immunoblot | 12680870 | - |
Par j 1 | Par j 1.0101 | PAHKARLE | Sequential / Linear | 118-125 | - | 106696 | IgE from serum of P judaica-allergic patients | - | - | - | Western / Immunoblot | 12680870 | - |
Par j 2 | Par j 2.0101 | CLHFVK | Sequential / Linear | 45-50 | - | 106310 | IgE from serum of P judaica-allergic patients | - | - | - | Western / Immunoblot | 12680870 | - |
Par j 2 | Par j 2.0101 | VKGEEKEPSK | Sequential / Linear | 49-58 | - | 106965 | IgE from serum of P judaica-allergic patients | - | - | - | Western / Immunoblot | 12680870 | - |
Par j 2 | Par j 2.0101 | CSGTKKLSEE | Sequential / Linear | 61-70 | - | 106315 | IgE from serum of P judaica-allergic patients | - | - | - | Western / Immunoblot | 12680870 | - |
Par j 2 | Par j 2.0101 | EEVKTTEQ | Sequential / Linear | 69-76 | - | 106378 | IgE from serum of P judaica-allergic patients | - | - | - | Western / Immunoblot | 12680870 | - |
Par j 2 | Par j 2.0101 | KREACKCIVR | Sequential / Linear | 77-86 | - | 106574 | IgE from serum of P judaica-allergic patients | - | - | - | Western / Immunoblot | 12680870 | - |
Par j 2 | Par j 2.0101 | CIVRATKGI | Sequential / Linear | 83-91 | - | 106306 | IgE from serum of P judaica-allergic patients | - | - | - | Western / Immunoblot | 12680870 | - |
Par j 2 | Par j 2.0101 | KKCDIKTT | Sequential / Linear | 104-111 | - | 106562 | IgE from serum of P judaica-allergic patients | - | - | - | Western / Immunoblot | 12680870 | - |
Par j 2 | Par j 2.0101 | SKIQSTIF | Sequential / Linear | 122-129 | - | 106848 | IgE from serum of P judaica-allergic patients | - | - | - | Western / Immunoblot | 12680870 | - |
Pen a 1 | Pen a 1.0101 | AADESERMRKVLENRSLSDEERMDALENQL | Sequential / Linear | 119-148 | - | - | IgE from serum of shrimp-allergic patients | - | - | Major epitope | Western / Immunoblot | 10224419 | - |
Pen a 1 | Pen a 1.0101 | FLAEEADRKYDEVARKLAMVEADLERA | Sequential / Linear | 153-179 | - | - | IgE from serum of shrimp-allergic patients | - | - | Major epitope | Western / Immunoblot | 10224419 | - |
Pen a 1 | Pen a 1.0101 | FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS | Sequential / Linear | 241-282 | - | - | IgE from serum of shrimp-allergic patients | - | - | Major epitope | Western / Immunoblot | 10224419 | - |
Pen c 13 | Pen c 13.0101 | ANVVQSNVPSWGLARISSK | Sequential / Linear | 116-134 | - | 164593 | IgE from serum of mold allergic patients | - | - | - | Western / Immunoblot | 22506037 | - |
Pen c 13 | Pen c 13.0101 | VCTIAASTSTDGSASFTNFGSVVD | Sequential / Linear | 296-319 | - | 165416 | IgE from serum of mold allergic patients | - | - | - | Western / Immunoblot | 22506037 | - |
Pen c 13 | Pen c 13.0101 | TNFGSVVDLYAPGQSITAAYPGGGSKTL | Sequential / Linear | 312-339 | - | 165352 | IgE from serum of mold allergic patients | - | - | - | Western / Immunoblot | 22506037 | - |
Pen c 13 | Pen c 13.0101 | ALEGVSAGNACARIVQLATSSISRAPSGTTSK | Sequential / Linear | 358-389 | - | 164583 | IgE from serum of mold allergic patients | - | - | Immunodominant epitope | Western / Immunoblot and Antigen Competition | 22506037 | - |
Pen c 13 | Pen c 13.0101 | STAGEGVVFYGVDTGIDISHSD | Sequential / Linear | 145-166 | - | 165281 | IgE from serum of mold allergic patients | - | - | - | Western / Immunoblot | 22506037 | - |
Pen c 13 | Pen c 13.0101 | GVDTGIDISHSDF | Sequential / Linear | 155-167 | - | 164772 | IgE from serum of mold allergic patients | - | - | - | Western / Immunoblot | 22506037 | - |
Pen c 13 | Pen c 13.0101 | WGTNVVDNDNTDGNGHGTHTASTAAGSK | Sequential / Linear | 173-200 | - | 165496 | IgE from serum of mold allergic patients | - | - | - | Western / Immunoblot | 22506037 | - |
Pen c 13 | Pen c 13.0101 | YGVAK | Sequential / Linear | 201-205 | - | 165519 | IgE from serum of mold allergic patients | - | - | - | Western / Immunoblot | 22506037 | - |
Pen c 13 | Pen c 13.0101 | VAVKVLGADGSGTNSGVISGMDW | Sequential / Linear | 210-232 | - | 165414 | IgE from serum of mold allergic patients | - | - | - | Western / Immunoblot | 22506037 | - |
Pen c 13 | Pen c 13.0101 | VLGADGSGTNSGVISGMDWAVK | Sequential / Linear | 214-235 | - | 165449 | IgE from serum of mold allergic patients | - | - | - | Western / Immunoblot | 22506037 | - |
Pen c 13 | Pen c 13.0101 | AKSRGANGKYVMNMSLGGE | Sequential / Linear | 237-255 | - | 164579 | IgE from serum of mold allergic patients | - | - | - | Western / Immunoblot | 22506037 | - |
Pen c 13 | Pen c 13.0101 | AAANVVKSGIFLSVAAGNE | Sequential / Linear | 263-281 | - | 164560 | IgE from serum of mold allergic patients | - | - | Immunodominant epitope | Western / Immunoblot and Antigen Competition | 22506037 | - |
Pen ch 13 | Pen ch 13.0101 | PSWGLSRISSK | Sequential / Linear | 124-134 | - | 49559 | IgE from serum of bronchial asthma patients allergic to Pen ch 13.0101 | - | - | - | Phage display-Immunoblot | 15663570 | - |
Pen ch 13 | Pen ch 13.0101 | GHADFGGR | Sequential / Linear | 163-170 | - | 20109 | IgE from serum of bronchial asthma patients allergic to Pen ch 13.0101 | - | - | Major epitope | Phage display-Immunoblot | 15663570 | - |
Pen ch 13 | Pen ch 13.0101 | IAGMDWAVKDSKSRGATGK | Sequential / Linear | 227-245 | - | - | IgE from serum of bronchial asthma patients allergic to Pen ch 13.0101 | - | - | - | Phage display-Immunoblot | 15663570 | - |
Pen ch 13 | Pen ch 13.0101 | SFTNFGSVV | Sequential / Linear | 310-318 | - | 57928 | IgE from serum of bronchial asthma patients allergic to Pen ch 13.0101 | - | - | - | Phage display-Immunoblot | 15663570 | - |
Pen ch 18 | Pen ch 18.0101 | GVDAYVIDTGANVKHVDFE | Sequential / Linear | 175-193 | - | 22932 | IgE from serum of allergic patients with bronchial asthma | - | - | - | Western / Immunoblot | 11964171 | - |
Pen ch 18 | Pen ch 18.0101 | SGTIAGKKF | Sequential / Linear | 219-227 | - | 58258 | IgE from serum of Pen ch 18.0101 allergic patients with bronchial asthma | - | - | Immunodominant epitope | Western / Immunoblot | 18760997 | - |
Pen ch 18 | Pen ch 18.0101 | EDGNGHGTHCSGTIAGKKFGVAK | Sequential / Linear | 209-231 | - | 11338 | IgE from serum of patients with bronchial asthma | - | - | Immunodominant epitope | Western / Immunoblot | 14510716 | - |
Pen ch 18 | Pen ch 18.0101 | VIDTGANVKHVDFEGRANW | Sequential / Linear | 180-198 | - | 68931 | IgE from serum of allergic patients with bronchial asthma | - | - | Immunodominant epitope | Western / Immunoblot | 11964171 | - |
Pen ch 18 | Pen ch 18.0101 | TIPQGDADEDGNGHGTHCSGTIAGK | Sequential / Linear | 201-225 | - | 64419 | IgE from serum of allergic patients with bronchial asthma | - | - | - | Western / Immunoblot | 11964171 | - |
Pen ch 18 | Pen ch 18.0101 | RSNGSGTMSDVVKGVEW | Sequential / Linear | 242-258 | - | 55909 | IgE from serum of allergic patients with bronchial asthma | - | - | - | Western / Immunoblot | 11964171 | - |
Pen ch 18 | Pen ch 18.0101 | AHIKKSKKGDKKFKGSVANMSLGGGSSRTLD | Sequential / Linear | 262-292 | - | 1777 | IgE from serum of allergic patients with bronchial asthma | - | - | - | Western / Immunoblot | 11964171 | - |
Pen ch 18 | Pen ch 18.0101 | ILSTWVGSDHATNTISGTSMA | Sequential / Linear | 358-378 | - | 27368 | IgE from serum of allergic patients with bronchial asthma | - | - | - | Western / Immunoblot | 11964171 | - |
Pen ch 18 | Pen ch 18.0101 | AVADVTPKQL | Sequential / Linear | 401-410 | - | 5247 | IgE from serum of allergic patients with bronchial asthma | - | - | - | Western / Immunoblot | 11964171 | - |
Pen ch 18 | Pen ch 18.0101 | KAALISVATEGTLTDIPSDTPNL | Sequential / Linear | 411-434 | - | 29753 | IgE from serum of allergic patients with bronchial asthma | - | - | - | Western / Immunoblot | 11964171 | - |
Pen ch 18 | Pen ch 18.0101 | GTLTDIPSDTPNLLAWNGGGSANYTKILADGGY | Sequential / Linear | 421-453 | - | 22751 | IgE from serum of allergic patients with bronchial asthma | - | - | - | Western / Immunoblot | 11964171 | - |
Pen i 1 | Pen i 1.0101 | MQQLENDLDQVQESLLK | Sequential / Linear | 50-66 | - | 42400 | IgE from serum of patients allergic to shrimp | - | - | - | Western / Immunoblot and Antigen Competition | 7693809 | - |
Pen i 1 | Pen i 1.0101 | FLAEEADRK | Sequential / Linear | 153-161 | - | 16496 | IgE from serum of patients allergic to shrimp | - | - | - | Western / Immunoblot and Antigen Competition | 7693809 | - |
Pen m 1 | Pen m 1.0101 | NRRIQLLEEDLERSEER | Sequential / Linear | 89-105 | - | 153863 | IgE from serum of shrimp allergic patients | - | - | Major epitope | Antigen Competition | 21802470 | - |
Pen m 1 | Pen m 1.0101 | EASQAADESERMRK | Sequential / Linear | 115-128 | - | 153821 | IgE from serum of shrimp allergic patients | - | - | Major epitope | Antigen Competition | 21802470 | - |
Pen m 1 | Pen m 1.0101 | ENRSLSDEERMD | Sequential / Linear | 131-142 | - | 153826 | IgE from serum of shrimp allergic patients | - | - | Major epitope | Antigen Competition | 21802470 | - |
Pen m 1 | Pen m 1.0101 | ENQLKEARFLAEEADRKYDE | Sequential / Linear | 145-164 | - | 153825 | IgE from serum of shrimp allergic patients | - | - | Major epitope | Antigen Competition | 21802470 | - |
Pen m 1 | Pen m 1.0101 | ERAEERAETGESKI | Sequential / Linear | 177-190 | - | 153828 | IgE from serum of shrimp allergic patients | - | - | Major epitope | Antigen Competition | 21802470 | - |
Pen m 1 | Pen m 1.0101 | SEEKANQREEAYKEQ | Sequential / Linear | 210-224 | - | 153886 | IgE from serum of shrimp allergic patients | - | - | Major epitope | Antigen Competition | 21802470 | - |
Pen m 1 | Pen m 1.0101 | ERSVQKLQKEVDRLEDE | Sequential / Linear | 243-259 | - | 153829 | IgE from serum of shrimp allergic patients | - | - | Major epitope | Antigen Competition | 21802470 | - |
Pen m 1 | Pen m 1.0101 | EKEKYKSITDELDQTFSE | Sequential / Linear | 263-280 | - | 153824 | IgE from serum of shrimp allergic patients | - | - | Major epitope | Antigen Competition | 21802470 | - |
Per a 1 | Per a 1.0104 | LIRALFGL | Sequential / Linear | 78-85 | - | 36679 | IgE from serum of patients sensitive to american cockroach | - | - | Major epitope | ELISA and Antigen Competition | 12413697 | - |
Per a 1 | Per a 1.0104 | IRSWFGLP | Sequential / Linear | 267-274 | - | 28405 | IgE from serum of patients sensitive to american cockroach | - | - | Major epitope | ELISA and Antigen Competition | 12413697 | - |
Per a 1 | Per a 1.0105 | QDLLQNLRDKGV | Sequential / Linear | 97-108 | - | 228647 | rPer a 1.0105-specific monoclonal antibody | - | - | - | Phage Display-ELISA | 24991456 | - |
Per a 10 | Per a 10.0101 | CAEQGYPGVYS | Sequential / Linear | 230-240 | - | 566773 | IgE from serum of cockroach hypersensitive patients | - | - | - | ELISA | 27792882 | - |
Per a 10 | Per a 10.0101 | QQGGKDACQGDSG | Sequential / Linear | 199-211 | - | 566886 | IgE from serum of cockroach hypersensitive patients | - | - | - | ELISA | 27792882 | - |
Per a 10 | Per a 10.0101 | SRSECNQAYSDY | Sequential / Linear | 175-186 | - | 566915 | IgE from serum of cockroach hypersensitive patients | - | - | - | ELISA | 27792882 | - |
Per a 2 | Per a 2.0101 | DTSSYTTVIPSASCVSGGCNCANVHKYYSN | Sequential / Linear | 57-86 | - | - | IgE from serum of Per a 2-allergic patients and Rabbit anti-Per a 2 antibody | - | - | - | ELISA | 25749772 | - |
Per a 2 | Per a 2.0101 | YYRGDFTYVPLV | Sequential / Linear | 200-211 | - | 422137 | IgE from serum of Per a 2-allergic patients and Rabbit anti-Per a 2 antibody | - | - | - | ELISA | 25749772 | - |
Per a 2 | Per a 2.0101 | TYHIQQNGDLC | Sequential / Linear | 299-309 | - | 422100 | IgE from serum of Per a 2-allergic patients and Rabbit anti-Per a 2 antibody | - | - | - | ELISA | 25749772 | - |
Per a 3 | Per a 3.0101 | TVLRDPVFYQ | Sequential / Linear | 400-409 | - | 67076 | IgE from serum of patients allergic to cockroach extract | - | - | - | ELISA and Antigen Competition | 14510715 | - |
Per a 3 | Per a 3.0101 | NNVDQI | Sequential / Linear | 466-471 | - | 45279 | IgE from serum of patients allergic to cockroach extract | - | - | - | ELISA and Antigen Competition | 14510715 | - |
Per a 3 | Per a 3.0101 | VDKGHNYCGYPENLLI | Sequential / Linear | 580-595 | - | 67994 | IgE from serum of patients allergic to cockroach extract | - | - | - | ELISA and Antigen Competition | 14510715 | - |
Per a 3 | Per a 3.0101 | IPKGKKGGQAY | Sequential / Linear | 595-605 | - | 27895 | IgE from serum of patients allergic to cockroach extract | - | - | - | ELISA and Antigen Competition | 14510715 | - |
Per a 5 | Per a 5.0102 | MTIDFYYLPGSAPCRSVLLA | Sequential / Linear | 1-20 | - | 742372 | IgE from serum of American cockroach allergic patients | - | - | - | ELISA | 29323160 | - |
Per a 5 | Per a 5.0102 | GFCLWESRAILSYLADQYGK | Sequential / Linear | 61-80 | - | 742320 | IgE from serum of American cockroach allergic patients | - | - | - | ELISA | 29323160 | - |
Per a 5 | Per a 5.01B | VTNLMAGEHLTPEFLK | Sequential / Linear | 32-47 | - | 1642391 | IgE from serum of cockroach sensitive patients | - | - | - | ELISA | 34717182 | - |
Per a 5 | Per a 5.01B | QYGKDDSLYRRDAKKR | Sequential / Linear | 77-92 | - | 1640648 | IgE from serum of cockroach sensitive patients | - | - | - | ELISA | 34717182 | - |
Per a 5 | Per a 5.01B | YYPIYFAKQAADPEKMKKLEEA | Sequential / Linear | 114-135 | - | 1642848 | IgE from serum of cockroach sensitive patients | - | - | - | ELISA | 34717182 | - |
Pha v PHA-E | - | NVNDNGEPTLSS | Sequential / Linear | 55-66 | - | 850860 | | - | - | - | ELISA | 30223257 | UniProtKB: V5QN77 |
Pha v PHA-E | - | VGSEPKDKGG | Sequential / Linear | 116-125 | - | 850891 | | - | - | - | ELISA | 30223257 | UniProtKB: V5QN77 |
Pha v PHA-E | - | NNYKYDSNAHT | Sequential / Linear | 131-141 | - | 850858 | | - | - | - | ELISA | 30223257 | UniProtKB: V5QN77 |
Pha v PHA-E | - | LYNVHWDPKPRH | Sequential / Linear | 149-160 | - | 850841 | | - | - | - | ELISA | 30223257 | UniProtKB: V5QN77 |
Phl p 1 | Phl p 1.0102 | APYHFDLSGHAFGAM | Sequential / Linear | 124-138 | 1N10 | 3912 | IgE from serum of grass pollen allergic patients | - | - | Immunodominant IgE hapten | Western / Immunoblot | 7525573 | - |
Pin p 1 | Pin p 1.0101 | QRRREQPS | Sequential / Linear | 61-68 | - | 1309258 | Sera from Pine nut allergic patients | - | - | - | Microarray | 32866706 | - |
Pin p 1 | Pin p 1.0101 | ERCCEEL | Sequential / Linear | 69-75 | - | 1309201 | Sera from Pine nut allergic patients | - | - | - | Microarray | 32866706 | - |
Pin p 1 | Pin p 1.0101 | NQRRRRR | Sequential / Linear | 112-118 | - | 1309246 | Sera from Pine nut allergic patients | - | - | - | Microarray | 32866706 | - |
Pin p 1 | Pin p 1.0101 | LPNRCNL | Sequential / Linear | 136-142 | - | 1309234 | Sera from Pine nut allergic patients | - | - | - | Microarray | 32866706 | - |
Pin p 1 | Pin p 1.0101 | RESPRRCDIRR | Sequential / Linear | 143-153 | - | 1309269 | Sera from Pine nut allergic patients | - | - | - | Microarray | 32866706 | - |
Pis s PsA | - | TETTSFLITKFSPDQ | Sequential / Linear | 31-45 | 1BQP 1HKD 1RIN 1OFS 2LTN 2BQP
| - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Pis s PsA | - | AHEVLSWSFHSELSGTSSSKQ | Sequential / Linear | 250-271 | - | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Pis s PsA | - | GDSYTTKEKLTLTKAVKNTVGRAL | Sequential / Linear | 52-75 | 1BQP 1HKD 1RIN 1OFS 2LTN 2BQP
| - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Pis s PsA | - | GNVANFVTS | Sequential / Linear | 88-96 | 1BQP 1HKD 1RIN 1OFS 2LTN 2BQP
| - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Pis s PsA | - | SYNVADGFTFFI | Sequential / Linear | 106-117 | 1BQP 1HKD 1RIN 1OFS 2LTN 2BQP
| - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Pis s PsA | - | VFNSAEYDK | Sequential / Linear | 133-141 | 1BQP 1HKD 1RIN 1OFS 2LTN 2BQP
| - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Pis s PsA | - | DTFYNAAWDPSN | Sequential / Linear | 151-162 | 1BQP 1HKD 1RIN 1OFS 2LTN 2BQP
| - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Pis s PsA | - | IDVNSIKSVNTKSWKLQNGEE | Sequential / Linear | 169-189 | 1BQP 1HKD 1RIN 1OFS 2LTN 2BQP
| - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Pis s PsA | - | VLTVSLTYPNVT | Sequential / Linear | 202-213 | 2BQP | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Pis s PsA | - | LKDVVPEW | Sequential / Linear | 229-236 | 2BQP | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Pis v 1 | Pis v 1.0101 | SGQSCQKQFEEQQKFKHCQMY | Sequential / Linear | 35-56 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 1 | Pis v 1.0101 | EVQKSQDGHSLTARINQR | Sequential / Linear | 60-77 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 1 | Pis v 1.0101 | CCQELQEVDKKCRCQNLEQMVKRQ | Sequential / Linear | 84-107 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 1 | Pis v 1.0101 | KLQELYETASELPRM | Sequential / Linear | 117-131 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | SEAGVTEFWDQNEEQLQC | Sequential / Linear | 59-76 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | ISVMRGLPLDVIQNSFDISREDAWNLKESRSEMTIF | Sequential / Linear | 426-461 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | QGSGIHGAVFPGCPETFQEES | Sequential / Linear | 107-127 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | EQHQKVRHIREGDIIALPAGV | Sequential / Linear | 146-166 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | NGQSKLVLVALADVGNSE | Sequential / Linear | 173-190 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | FVLGGSPQQEIQGGGQSW | Sequential / Linear | 200-217 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | RSSRKGQQSNNILSAFDE | Sequential / Linear | 221-238 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | KEDLQVLSPQRQEKEYSDNGLEETFCT | Sequential / Linear | 269-295 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | SIVYITRGNGRMQIVSENGESVFDEEIREGQLV | Sequential / Linear | 357-389 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | QNFAVVKRASSDGFEWVS | Sequential / Linear | 393-410 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | EQCAKGCEKYYKEKKGRE | Sequential / Linear | 51-68 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | MKQCERQDGGQQKQLCRFRCQEKYKKERREHSYS | Sequential / Linear | 105-134 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | TKRSKLLRGLEKYRLAFL | Sequential / Linear | 180-197 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | FFVSWGRGTITKIRENKRES | Sequential / Linear | 216-235 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | MNVKQGDIIRIRAGTPFYI | Sequential / Linear | 236-254 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | IVKASKEQIRAMSRRGE | Sequential / Linear | 324-340 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | GPSIWPFTGK | Sequential / Linear | 341-350 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | NITKGGMSGPFYNSRATK | Sequential / Linear | 393-410 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 3 | Pis v 3.0101 | KNSGQEKSGPSYKKLSSSIRTDSV | Sequential / Linear | 432-455 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Poa p 5 | Poa p 5.0101 | AAVDSSKAALTSKLDAAYKL | Sequential / Linear | 111-130 | - | 481 | IgE from pooled serum of grass-allergic patients | - | - | - | ELISA | 8698392 | UniProtKB:P22286 |
Poa p 5 | Poa p 5.0101 | SQAQKAAKPAAAATGTATAA | Sequential / Linear | 271-290 | - | 60374 | IgE from pooled serum of grass-allergic patients | - | - | - | ELISA | 8698392 | UniProtKB:P22286 |
Poa p 5 | Poa p 5.0101 | AEEVKATPAGELQVIDKVDA | Sequential / Linear | 171-190 | - | 895 | IgE from pooled serum of grass-allergic patients | - | - | - | ELISA | 8698392 | UniProtKB:P22286 |
Poa p 5 | Poa p 5.0101 | AFKVAATAANAAPANDKFTV | Sequential / Linear | 191-210 | - | 1336 | IgE from pooled serum of grass-allergic patients | - | - | - | ELISA | 8698392 | UniProtKB:P22286 |
Poa p 5 | Poa p 5.0101 | AAPANDKFTVFEAAFNDAIK | Sequential / Linear | 201-220 | - | 346 | IgE from pooled serum of grass-allergic patients | - | - | - | ELISA | 8698392 | UniProtKB:P22286 |
Poa p 5 | Poa p 5.0101 | ASTGGAYQSYKFIPALEAAV | Sequential / Linear | 221-240 | - | 4792 | IgE from pooled serum of grass-allergic patients | - | - | - | ELISA | 8698392 | UniProtKB:P22286 |
Poa p 5 | Poa p 5.0101 | KFIPALEAAVKQSYAATVAT | Sequential / Linear | 231-250 | - | 30748 | IgE from pooled serum of grass-allergic patients | - | - | - | ELISA | 8698392 | UniProtKB:P22286 |
Poa p 5 | Poa p 5.0101 | KQSYAATVATAPAVKYTVFE | Sequential / Linear | 241-260 | - | 33077 | IgE from pooled serum of grass-allergic patients | - | - | - | ELISA | 8698392 | UniProtKB:P22286 |
Poa p 5 | Poa p 5.0101 | APAVKYTVFETALKKAITAM | Sequential / Linear | 251-270 | - | 3493 | IgE from pooled serum of grass-allergic patients | - | - | - | ELISA | 8698392 | UniProtKB:P22286 |
Poa p 5 | Poa p 5.0101 | TALKKAITAMSQAQKAAKPA | Sequential / Linear | 261-280 | - | 62912 | IgE from pooled serum of grass-allergic patients | - | - | - | ELISA | 8698392 | UniProtKB:P22286 |
Poly p 5 | Poly p 5.0102 | VGHYTQVVWAKTKE | Sequential / Linear | 157-170 | - | - | IgE from pooled serum of patients allergic to P paulista venom | - | - | Major epitope | ELISA, Western / Immunoblot | 25129676 | - |
Pru ar 3 | Pru ar 3.0101 | YVRGGGAVP | Sequential / Linear | 16-24 | - | 76396 | IgE from pooled serum of patients allergic to Rosaceae fruits | - | - | - | Western / Immunoblot | 18036340 | - |
Pru ar 3 | Pru ar 3.0101 | LARTTPDRRTACNCL | Sequential / Linear | 37-51 | - | 54951 | IgE from pooled serum of patients allergic to Rosaceae fruits | - | - | - | Western / Immunoblot | 18036340 | - |
Pru ar 3 | Pru ar 3.0101 | NNAAAL | Sequential / Linear | 64-69 | - | 70153 | IgE from pooled serum of patients allergic to Rosaceae fruits | - | - | - | Western / Immunoblot | 18036340 | - |
Pru ar 3 | Pru ar 3.0101 | NIPYKISASTNCATVK | Sequential / Linear | 76-91 | - | 44314 | IgE from pooled serum of patients allergic to Rosaceae fruits | - | - | - | Western / Immunoblot | 18036340 | - |
Pru d 3 | Pru d 3.0101 | YVKGGGAVP | Sequential / Linear | 100-108 | - | 76310 | IgE from pooled serum of patients allergic to Rosaceae fruits | - | - | - | Western / Immunoblot | 18036340 | - |
Pru d 3 | Pru d 3.0101 | LARTTADRRAACNCLKQL | Sequential / Linear | 37-54 | - | 34950 | IgE from pooled serum of patients allergic to Rosaceae fruits | - | - | - | Western / Immunoblot | 18036340 | - |
Pru d 3 | Pru d 3.0101 | NNAAAL | Sequential / Linear | 64-69 | - | 70153 | IgE from pooled serum of patients allergic to Rosaceae fruits | - | - | - | Western / Immunoblot | 18036340 | - |
Pru d 3 | Pru d 3.0101 | NVPYKISASTNCATVK | Sequential / Linear | 76-91 | - | 46455 | IgE from pooled serum of patients allergic to Rosaceae fruits | - | - | - | Western / Immunoblot | 18036340 | - |
Pru du 6 | Pru du 6.0101 | SSQQGRQQEQEQERQ | Sequential / Linear | 118-132 | - | 156272 | IgE from pooled serum of almond-allergic patients | - | - | - | Immunoblot(Antigen Competition) | 21720172 | - |
Pru du 6 | Pru du 6.0101 | QQEQQQERQGRQQGR | Sequential / Linear | 145-159 | - | 156426 | IgE from pooled serum of almond-allergic patients | - | - | - | Immunoblot(Antigen Competition) | 21720172 | - |
Pru du 6 | Pru du 6.0101 | QQEEGRQQEQQQGQQ | Sequential / Linear | 161-175 | - | 156424 | IgE from pooled serum of almond-allergic patients | - | - | - | Immunoblot(Antigen Competition) | 21720172 | - |
Pru du 6 | Pru du 6.0101 | LFHVSSDHNQLDQNP | Sequential / Linear | 225-239 | 3FZ3 3EHK | 156358 | IgE from pooled serum of almond-allergic patients | - | - | - | Immunoblot(Antigen Competition) | 21720172 | - |
Pru du 6 | Pru du 6.0101 | QQEQQGSGNNVFSGF | Sequential / Linear | 281-295 | - | 156425 | IgE from pooled serum of almond-allergic patients | - | - | - | Immunoblot(Antigen Competition) | 21720172 | - |
Pru du 6 | Pru du 6.0101 | RALPDEVLANAYQIS | Sequential / Linear | 510-524 | 3FZ3 3EHK | 156448 | IgE from pooled serum of almond-allergic patients | - | - | - | Immunoblot(Antigen Competition) | 21720172 | - |
Pru du 6 | Pru du 6.0201 | FGQNKEWQLNQLEAR | Sequential / Linear | 17-31 | - | 156291 | IgE from pooled serum of almond-allergic patients | - | - | - | Immunoblot(Antigen Competition) | 21720172 | - |
Pru du 6 | Pru du 6.0201 | DSQPQQFQQQQQQQQ | Sequential / Linear | 105-119 | - | 156260 | IgE from pooled serum of almond-allergic patients | - | - | - | Immunoblot(Antigen Competition) | 21720172 | - |
Pru du 6 | Pru du 6.0201 | RPSRQEGGQGQQQFQ | Sequential / Linear | 121-135 | - | 156444 | IgE from pooled serum of almond-allergic patients | - | - | - | Immunoblot(Antigen Competition) | 21720172 | - |
Pru du 6 | Pru du 6.0201 | QNQLDQVPRRFYLAG | Sequential / Linear | 185-199 | - | 156423 | IgE from pooled serum of almond-allergic patients | - | - | - | Immunoblot(Antigen Competition) | 21720172 | - |
Pru du 6 | Pru du 6.0201 | QQGRQQQQQQQGQQG | Sequential / Linear | 209-223 | - | 156427 | IgE from pooled serum of almond-allergic patients | - | - | - | Immunoblot(Antigen Competition) | 21720172 | - |
Pru du 6 | Pru du 6.0201 | GNNIFSGFDTQLLAQ | Sequential / Linear | 225-239 | - | 156317 | IgE from pooled serum of almond-allergic patients | - | - | - | Immunoblot(Antigen Competition) | 21720172 | - |
Pru du 6 | Pru du 6.0201 | RGDQERQQEEQQSQR | Sequential / Linear | 281-295 | - | 156435 | IgE from pooled serum of almond-allergic patients | - | - | - | Immunoblot(Antigen Competition) | 21720172 | - |
Pru du 6 | Pru du 6.0201 | QNAFRISRQEARNLK | Sequential / Linear | 465-479 | - | 156421 | IgE from pooled serum of almond-allergic patients | - | - | - | Immunoblot(Antigen Competition) | 21720172 | - |
Pru p 3 | Pru p 3.0101 | RNVNNLARTT | Sequential / Linear | 32-41 | 2ALG 2B5S | - | IgE from serum of patients with baker’s asthma | - | - | - | Western / Immunoblot | 19846220 | Tri a 14 homologous epitope |
Pru p 3 | Pru p 3.0101 | ITCGQVSSSLAPCIPYVRGG | Sequential / Linear | 1-20 | 2ALG 2B5S | 2140550 | IgE from peach allergic patients | - | - | - | Microarray | 35935018 | - |
Pru p 3 | Pru p 3.0101 | SSSLAPCIPYVRGGGAVPPA | Sequential / Linear | 7-26 | 2ALG 2B5S | 2143446 | IgE from peach allergic patients | - | - | - | Microarray | 35935018 | - |
Pru p 3 | Pru p 3.0101 | VNPNNAAALPGKCGVSIPYK | Sequential / Linear | 61-80 | 2ALG 2B5S | 2144177 | IgE from peach allergic patients | - | - | - | Microarray | 35935018 | - |
Pru p 3 | Pru p 3.0101 | PGKCGVSIPYKISASTNCAT | Sequential / Linear | 70-89 | 2ALG 2B5S | 2142002 | IgE from peach allergic patients | - | - | - | Microarray | 35935018 | - |
Pru p 3 | Pru p 3.0101 | KCGVHIPYKISASTNCATVK | Sequential / Linear | 72-91 | 2ALG 2B5S | 3502 | IgE from serum of patients with baker’s asthma | - | - | - | Western / Immunoblot | 19846220 | Tri a 14 homologous epitope |
Pru p 3 | Pru p 3.0101 | APCIPYVRGG | Sequential / Linear | 11-20 | 2ALG 2B5S | 3502 | IgE from pooled serum of patients allergic to peach | - | - | Major epitope | Western / Immunoblot | 13679821 | - |
Pru p 3 | Pru p 3.0101 | IRNVNNLARTTPDRQ | Sequential / Linear | 31-45 | 2ALG 2B5S |
( ! ) Deprecated: Function split() is deprecated in C:\wamp\www\AllerBase\PHP_codes\BrSeqEpi.php on line 606 |
Call Stack |
# | Time | Memory | Function | Location |
1 | 0.0008 | 791440 | {main}( ) | ..\BrSeqEpi.php:0 |
28349 44654
| IgE from pooled serum of patients allergic to peach | - | - | Major epitope | Western / Immunoblot | 13679821 | - |
Pru p 3 | Pru p 3.0101 | GKCGVSIPYK | Sequential / Linear | 71-80 | 2ALG 2B5S | 20523 | IgE from pooled serum of patients allergic to peach | - | - | Major epitope | Western / Immunoblot | 13679821 | - |
Pru p 3 | Pru p 3.0101 | RTTPDRQAA | Sequential / Linear | 39-47 | - | 56195 | IgE from patients allergic to fruit nsLTPs | - | - | - | ELISA | 17059861 | - |
Pru p 3 | Pru p 3.0101 | ITCGQVSSALAPCIPY | Sequential / Linear | 1-16 | - | 137538 | IgE from peach allergic patients | - | - | Major epitope | Immune Slot-blot Microarray | 35749217 | - |
Pru p 3 | Pru p 3.0101 | PCIPYVRGGGAVPPAC | Sequential / Linear | 12-27 | 2ALG 2B5S | 137550 | IgE from peach allergic patients | - | - | Major epitope | Immune Slot-blot Microarray | 35749217 | - |
Pru p 3 | Pru p 3.0101 | VPPACCNGIRNVNNLA | Sequential / Linear | 23-38 | 2ALG 2B5S | 137582 | IgE from peach allergic patients | - | - | Major epitope | Immune Slot-blot Microarray | 35749217 | - |
Rap v 2 | Rap v 2.0101 | VRKVSRTYNVYRGSSPST | Sequential / Linear | 10-27 | - | - | Sera from sea-snail-allergic patients | - | - | - | Dot blot | 33929822 | - |
Rap v 2 | Rap v 2.0101 | ESRIRELEDALDSERD | Sequential / Linear | 32-47 | - | - | Sera from sea-snail-allergic patients | - | - | - | Dot blot | 33929822 | - |
Rap v 2 | Rap v 2.0101 | DQLQDSLDEQGTSTSAQM | Sequential / Linear | 64-81 | - | - | Sera from sea-snail-allergic patients | - | - | - | Dot blot | 33929822 | - |
Rap v 2 | Rap v 2.0101 | EATESSMRKRH | Sequential / Linear | 106-116 | - | - | Sera from sea-snail-allergic patients | - | - | - | Dot blot | 33929822 | - |
Rap v 2 | Rap v 2.0101 | TSTNLRNQLSKVNADYS | Sequential / Linear | 273-289 | - | - | Sera from sea-snail-allergic patients | - | - | - | Dot blot | 33929822 | - |
Rap v 2 | Rap v 2.0101 | DLTKRNRQLENENA | Sequential / Linear | 361-374 | - | - | Sera from sea-snail-allergic patients | - | - | - | Dot blot | 33929822 | - |
Rap v 2 | Rap v 2.0101 | DMENRLREKDEE | Sequential / Linear | 491-502 | - | - | Sera from sea-snail-allergic patients | - | - | - | Dot blot | 33929822 | - |
Rhi o 1 | Rhi o 1.0101 | TGEYLTQKYFNSQRNN | Sequential / Linear | 44-59 | - | 549251 | IgE from serum of mold-allergic patients | - | - | - | ELISA | 27358405 | - |
Rhi o 1 | Rhi o 1.0101 | GAEKNWAGQYVVDCNK | Sequential / Linear | 311-326 | - | 549154 | IgE from serum of mold-allergic patients | - | - | - | ELISA | 27358405 | - |
Rhi o 2 | Rhi o 2.0101 | NKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFITTIKCSWLDGKHVVFGRVTEGMDVVQNIESLGSPN | Sequential / Linear | 81-149 | - | - | Sera from patients with fungal | - | - | - | Immunoblot, Mutagenesis | 31882546 | Fragment contaning site of IgE recognition and cross-reactivity |
Ric c 1 | Ric c 1.0101 | ESKGEREGSSSQQCR | Sequential / Linear | 36-50 | 1PSY | - | IgE from serum of Castor bean allergic patients | - | - | - | Western / Immunoblot and mast cell degranulation assay | 18262682 | - |
Ric c 1 | Ric c 1.0101 | QEVQRKDLSSCERYLRQSSS | Sequential / Linear | 51-70 | 1PSY | - | IgE from serum of Castor bean allergic patients | - | - | - | Western / Immunoblot and mast cell degranulation assay | 18262682 | - |
Ric c 1 | Ric c 1.0101 | DECQCEAIKYIAEDQQGQ | Sequential / Linear | 105-123 | 1PSY | - | IgE from serum of Castor bean allergic patients | - | - | - | Western / Immunoblot and mast cell degranulation assay | 18262682 | - |
Ric c 1 | Ric c 1.0101 | LHGEESERVAQRAGE | Sequential / Linear | 125-140 | 1PSY | - | IgE from serum of Castor bean allergic patients | - | - | - | Western / Immunoblot and mast cell degranulation assay | 18262682 | - |
Ric c 1 | Ric c 1.0101 | QEQQNLRQCQEYIKQ | Sequential / Linear | 167-181 | - | - | IgE from serum of Castor bean allergic patients | - | - | - | Western / Immunoblot and mast cell degranulation assay | 18262682 | - |
Ric c 1 | Ric c 1.0101 | EGLRQAIEQQQSQGQ | Sequential / Linear | 215-229 | - | - | IgE from serum of Castor bean allergic patients | - | - | Immunodominant epitope | Western / Immunoblot and mast cell degranulation assay | 18262682 | - |
Sal s 1 | Sal s 1.0101 | MACAHLCKEADIKTALEA | Sequential / Linear | 1-18 | - | 159002 | Serum of fish-allergic patients with specific IgE to salmon parvalbumin | - | - | - | ELISA | 21894026 | - |
Sal s 1 | Sal s 1.0101 | KTFFHTIGFASKSADDVK | Sequential / Linear | 28-45 | - | 158933 | Serum of fish-allergic patients with specific IgE to salmon parvalbumin | - | - | - | ELISA | 21894026 | - |
Sal s 1 | Sal s 1.0101 | VEELKLFLQNFCPKARELTDA | Sequential / Linear | 61-81 | - | 159180 | Serum of fish-allergic patients with specific IgE to salmon parvalbumin | - | - | - | ELISA | 21894026 | - |
Sal s 1 | Sal s 1.0101 | ACAHLCK | Sequential / Linear | 2-8 | - | 910682 | Sera from healthy and fish allergic patients | - | - | - | ELISA | 30974223 | - |
Sal s 1 | Sal s 1.0101 | FAVLVKQ | Sequential / Linear | 103-109 | - | 910721 | Sera from healthy and fish allergic patients | - | - | - | ELISA | 30974223 | - |
Sch j Sj22 | - | DTDKDGKVSLEEFCR | Sequential / Linear | 56-70 | - | 10312 | IgE from pooled serum of individuals infected with S. japonicum | - | - | - | Western / Immunoblot | 9784652 | - |
Sch j Sj22 | - | LKKDKEGKVSTLPLD | Sequential / Linear | 86-100 | - | 36903 | IgE from pooled serum of individuals infected with S. japonicum | - | - | - | Western / Immunoblot | 9784652 | - |
Sch j Sj22 | - | MSKAKQYNICCKFKE | Sequential / Linear | 108-122 | - | 42580 | IgE from pooled serum of individuals infected with S. japonicum | - | - | - | Western / Immunoblot | 9784652 | - |
Sch j Sj22 | - | FKYSNYVCLLWRTPS | Sequential / Linear | 176-190 | - | 16487 | IgE from pooled serum of individuals infected with S. japonicum | - | - | - | Western / Immunoblot | 9784652 | - |
Sco j 1 | - | AGSFDHKKFFKACGLSGKST | Sequential / Linear | 22-41 | 5XND | - | IgE from serum of fish-allergic patients | - | - | - | Fluorescence ELISA | DOI:10.1016/j.foodchem.2008.04.062 | - |
Scy p 1 | Scy p 1.0101 | KIVELEEELRVVGNNLKSLEVS | Sequential / Linear | 189-210 | - | 2144619 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | UniProtKB:A0A6C0N3G5 |
Scy p 1 | Scy p 1.0101 | EEKANQREETYKEQIKTLANK | Sequential / Linear | 211-231 | - | 2144618 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | UniProtKB:A0A6C0N3G5 |
Scy p 1 | Scy p 1.0101 | AQEQLSAANTKL | Sequential / Linear | 60-71 | - | 2144611 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | UniProtKB:A0A6C0N3G5 |
Scy p 1 | Scy p 1.0101 | ALQNAEGEVAALNR | Sequential / Linear | 77-90 | - | 2144610 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | UniProtKB:A0A6C0N3G5 |
Scy p 1 | Scy p 1.0101 | RSEERLNTAT | Sequential / Linear | 101-110 | - | 2144630 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | UniProtKB:A0A6C0N3G5 |
Scy p 1 | Scy p 1.0101 | LAEASQAADESER | Sequential / Linear | 113-125 | - | 2144620 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | UniProtKB:A0A6C0N3G5 |
Scy p 1 | Scy p 1.0101 | MRKVLENRSLSDEE | Sequential / Linear | 126-139 | - | 2144626 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | UniProtKB:A0A6C0N3G5 |
Scy p 1 | Scy p 1.0101 | RMDALENQLKEARFLAEEADRKY | Sequential / Linear | 140-162 | - | 2144629 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | UniProtKB:A0A6C0N3G5 |
Scy p 1 | Scy p 1.0101 | DEVARKLAMVEAD | Sequential / Linear | 163-175 | - | 2144617 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | UniProtKB:A0A6C0N3G5 |
Scy p 1 | Scy p 1.0101 | LERAEERAESGES | Sequential / Linear | 176-188 | - | 2144622 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | UniProtKB:A0A6C0N3G5 |
Scy p 2 | Scy p 2.0101 | CGRSMEGYPFNPCLT | Sequential / Linear | 123-137 | - | 189207 | IgE from serum of crab allergic patients | - | - | - | Western / Immunoblot | 23911402 | - |
Scy p 2 | Scy p 2.0101 | TEAQYKEMESKVSST | Sequential / Linear | 137-151 | - | 189302 | IgE from serum of crab allergic patients | - | - | - | Western / Immunoblot | 23911402 | - |
Scy p 2 | Scy p 2.0101 | YHNDNKTFLVWCNEE | Sequential / Linear | 207-221 | - | 189308 | IgE from serum of crab allergic patients | - | - | - | Western / Immunoblot | 23911402 | - |
Scy p 2 | Scy p 2.0101 | VDPDGKFVISTRVRC | Sequential / Linear | 109-123 | - | 418896 | IgE from serum of crab allergic patients | - | - | - | Dot blot and Degranulation assay | 25728640 | - |
Scy p 3 | Scy p 3.0101 | ARDVERAKFAFSIYDFEG | Sequential / Linear | 7-24 | - | 2144612 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | - |
Scy p 3 | Scy p 3.0101 | DCLRALNLNPTLAVIE | Sequential / Linear | 35-50 | - | 2144614 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | - |
Scy p 3 | Scy p 3.0101 | KVGGKTKKKEK | Sequential / Linear | 51-61 | - | 933435 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | - |
Scy p 3 | Scy p 3.0101 | DDFLPIFAQVKKDKDAGSFEDF | Sequential / Linear | 66-67 | - | 2144615 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | - |
Scy p 3 | Scy p 3.0101 | KTENGTMLYAE | Sequential / Linear | 96-106 | - | 933433 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | - |
Scy p 3 | Scy p 3.0101 | LEHILLSLGERLEKSELEP | Sequential / Linear | 107-125 | - | 2144621 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | - |
Scy p 3 | Scy p 3.0101 | DEDGFIPYEPFLK | Sequential / Linear | 135-147 | - | 933347 | IgE from crab allergic patients | - | - | - | Dot blot | 36110087 | - |
Scy p 4 | Scy p 4.0101 | QVTVDEFKQAVKNLCC | Sequential / Linear | 76-91 | - | 1813887 | Sera from carb-allergic patients | - | - | - | Dot blot, ELISA | 34689550 | - |
Scy p 4 | Scy p 4.0101 | KTIDINGDGLVGVDE | Sequential / Linear | 111-125 | - | 1781363 | Sera from carb-allergic patients | - | - | - | Dot blot, ELISA | 34689550 | - |
Scy p 4 | Scy p 4.0101 | AFSSVKEIDD | Sequential / Linear | 137-146 | - | 1718988 | Sera from carb-allergic patients | - | - | - | Dot blot, ELISA | 34689550 | - |
Scy p 9 | Scy p 9.0101 | GTNRQTERIKRQREAVPL | Sequential / Linear | 336-353 | 7VZO | 1861496 | Sera of patients allergic to crab | - | - | - | Dot blot, ELISA | 35040643 | - |
Scy p 9 | Scy p 9.0101 | TFKLPGISPFDLGAT | Sequential / Linear | 363-377 | 7VZO | 1862499 | Sera of patients allergic to crab | - | - | - | Dot blot, ELISA | 35040643 | - |
Scy p 9 | Scy p 9.0101 | EMHIPGSPFQFTVGPL | Sequential / Linear | 418-433 | 7VZO | 1861245 | Sera of patients allergic to crab | - | - | - | Dot blot, ELISA | 35040643 | - |
Scy p 9 | Scy p 9.0101 | PGLERGEQGMPNEFNVW | Sequential / Linear | 446-462 | 7VZO | 1862121 | Sera of patients allergic to crab | - | - | - | Dot blot, ELISA | 35040643 | - |
Scy p 9 | Scy p 9.0101 | DGSCYVSYVVAEPGEY | Sequential / Linear | 490-505 | 7VZO | 1861130 | Sera of patients allergic to crab | - | - | - | Dot blot, ELISA | 35040643 | - |
Scy p 9 | Scy p 9.0101 | NDKHIPDSPYKVYITPS | Sequential / Linear | 512-528 | 7VZO | 1862044 | Sera of patients allergic to crab | - | - | - | Dot blot, ELISA | 35040643 | - |
Scy s Trp | - | RATQKKMQQVEN | Sequential / Linear | 44-55 | - | - | IgE from serum of crab-allergic patients | - | - | - | ELISA / Blot | 30107732 | - |
Ses i 2 | Ses i 2.0101 | SRQCQMRHCM | Sequential / Linear | 46-55 | - | - | IgE from serum of sesame allergic patients | - | - | Immunodominant epitope | Western / Immunoblot | 15536424 | - |
Ses i 2 | Ses i 2.0101 | QCQMRHCMQW | Sequential / Linear | 48-57 | - | 50419 | IgE from serum of sesame allergic patients | - | - | Immunodominant epitope | Western / Immunoblot | 15536424 | - |
Ses i 2 | Ses i 2.0101 | CMQWMRSMRG | Sequential / Linear | 54-63 | - | 6663 | IgE from serum of sesame allergic patients | - | - | - | Western / Immunoblot | 15536424 | - |
Ses i 2 | Ses i 2.0101 | EANQGQFEHF | Sequential / Linear | 74-83 | - | 11149 | IgE from serum of sesame allergic patients | - | - | - | Western / Immunoblot | 15536424 | - |
Ses i 2 | Ses i 2.0101 | NQGQFEHFREC | Sequential / Linear | 76-86 | - | 45561 | IgE from serum of sesame allergic patients | - | - | Immunodominant epitope | Western / Immunoblot | 15536424 | - |
Ses i 2 | Ses i 2.0101 | GQFEHFRECC | Sequential / Linear | 78-87 | - | 21860 | IgE from serum of sesame allergic patients | - | - | - | Western / Immunoblot | 15536424 | - |
Ses i 2 | Ses i 2.0101 | FEHFRECCNE | Sequential / Linear | 80-89 | - | 15547 | IgE from serum of sesame allergic patients | - | - | - | Western / Immunoblot | 15536424 | - |
Ses i 2 | Ses i 2.0101 | HFRECCNEIR | Sequential / Linear | 82-91 | - | 23863 | IgE from serum of sesame allergic patients | - | - | - | Western / Immunoblot | 15536424 | - |
Ses i 2 | Ses i 2.0101 | RECCNEIRDVK | Sequential / Linear | 84-94 | - | 53464 | IgE from serum of sesame allergic patients | - | - | - | Western / Immunoblot | 15536424 | - |
Ses i 3 | Ses i 3.0101 | NPTDPEKQYQQCRLQCRRQGEG | Sequential / Linear | 125-147 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 3 |
Ses i 3 | Ses i 3.0101 | QLHEVDASQYRQLRD | Sequential / Linear | 410-424 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 3 |
Ses i 3 | Ses i 3.0101 | RRNVMNQLEREAKEL | Sequential / Linear | 536-550 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 3 |
Ses i 3 | Ses i 3.0101 | MPAREVEEVSRSQQEEFF | Sequential / Linear | 554-571 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 3 |
Ses i 3 | Ses i 3.0101 | PYVFEDQHFITGFRTQHGRMRVLQ | Sequential / Linear | 195-218 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 3 |
Ses i 3 | Ses i 3.0101 | DRSELLRGIENYRV | Sequential / Linear | 222-235 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 3 |
Ses i 3 | Ses i 3.0101 | FIVPNHWDAESVVFV | Sequential / Linear | 245-259 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 3 |
Ses i 3 | Ses i 3.0101 | INAGTTAYLINRDNNERL | Sequential / Linear | 287-304 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 3 |
Ses i 3 | Ses i 3.0101 | VLAKLLQPVSTPGEF | Sequential / Linear | 305-319 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 3 |
Ses i 3 | Ses i 3.0101 | ELFFGAGGENPE | Sequential / Linear | 320-331 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 3 |
Ses i 3 | Ses i 3.0101 | SFFKSFSDEILEAAFNTRRDRLQRIFG | Sequential / Linear | 332-358 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 3 |
Ses i 3 | Ses i 3.0101 | INIYQQRPTHSNQYG | Sequential / Linear | 395-409 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 3 |
Ses i 6 | Ses i 6.0101 | QTREPRLTQGQQCRFQRISGAQPSLRI | Sequential / Linear | 22-48 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | ISPNQAQALKMNRGSQSFLLSPGGRRS | Sequential / Linear | 433-459 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | QFQCAGIVAMRSTIRPNGLSLPNY | Sequential / Linear | 64-87 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | GCAETYQVHRSQRTMERTEASEQQDRGSVRDLHQKVHRLRQG | Sequential / Linear | 109-150 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | DVNHLSNQLDQKFRAFYLAGGVPRSGEQEQQARQTF | Sequential / Linear | 178-213 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | GLIVMARERMTFVRP | Sequential / Linear | 247-261 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | NGLEETFCTMKFRTN | Sequential / Linear | 277-291 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | FSRQAGRVHVVDRNKLPILKYMDL | Sequential / Linear | 301-324 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | PDWSMTGHTIVYVTRG | Sequential / Linear | 349-354 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | GEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMP | Sequential / Linear | 375-423 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Sta c 3 | Sta c 3.0101 | VKQMWPAESRKPMSG | Sequential / Linear | 91-105 | - | 165448 | IgE from serum of S. chartarum allergic patient | - | - | Immunodominant epitope | Western / Immunoblot | 22424314 | Also an IgG-binding epitope |
Tri a 14 | Tri a 14.0101 | KNLHNQARSQ | Sequential / Linear | 55-64 | 1BWO 1CZ2 1GH1 | 117396 | IgE from serum of patients with baker’s asthma | - | - | - | Western / Immunoblot | 19846220 | - |
Tri a 14 | Tri a 14.0101 | KGIARGIHNL | Sequential / Linear | 75-84 | 1BWO 1CZ2 1GH1 | - | IgE from serum of patients with baker’s asthma | - | - | - | Western / Immunoblot | 19846220 | - |
Tri a 14 | Tri a 14.0101 | RSIPPKCGVNLPYTI | Sequential / Linear | 90-104 | 1BWO 1CZ2 1GH1 | - | IgE from serum of patients with baker’s asthma | - | - | - | Western / Immunoblot | 19846220 | - |
Tri a 15 | Tri a 15.0101 | SWCDPATGYKVSALTGCRAMV | Sequential / Linear | 5-25 | - | 62430 | IgE from serum of patients with baker's asthma | - | - | - | ELISA, RAST | 2474614 | - |
Tri a 19 | Tri a 19.0101 | QQIPQQQ | Sequential / Linear | 77-83 | - | 52043 | IgE from serum of patients with WDEIA | - | - | Immunodominant epitope | ELISA and Western / Immunoblot | 14699123 | - |
Tri a 19 | Tri a 19.0101 | QQPPQQ | Sequential / Linear | 163-168 | - | 52097 | IgE from serum of patients with WDEIA | - | - | - | ELISA | 16128812 | - |
Tri a 19 | Tri a 19.0101 | QQFHQQQ | Sequential / Linear | 336-342 | - | 52023 | IgE from serum of patients with WDEIA | - | - | - | ELISA | 16128812 | - |
Tri a 19 | Tri a 19.0101 | QQFPQQQ | Sequential / Linear | 47-53 | - | 52028 | IgE from serum of patients with WDEIA | - | - | Immunodominant epitope | ELISA and Western / Immunoblot | 14699123 | - |
Tri a 19 | Tri a 19.0101 | QQSPQQQ | Sequential / Linear | 268-274 | - | 52152 | IgE from serum of patients with WDEIA | - | - | Immunodominant epitope | ELISA and Western / Immunoblot | 14699123 | - |
Tri a 19 | Tri a 19.0101 | QQSPEQQ | Sequential / Linear | 379-385 | - | 52151 | IgE from serum of patients with WDEIA | - | - | Immunodominant epitope | ELISA and Western / Immunoblot | 14699123 | - |
Tri a 19 | Tri a 19.0101 | QQLPQQQ | Sequential / Linear | 139-145 | - | 52066 | IgE from serum of patients with WDEIA | - | - | - | ELISA and Western / Immunoblot | 14699123 | - |
Tri a 19 | Tri a 19.0101 | QQYPQQQ | Sequential / Linear | 421-427 | - | 52180 | IgE from serum of patients with WDEIA | - | - | - | ELISA and Western / Immunoblot | 14699123 | - |
Tri a 19 | Tri a 19.0101 | PYPP | Sequential / Linear | 408-411 | - | 50149 | IgE from serum of patients with WDEIA | - | - | - | ELISA and Western / Immunoblot | 14699123 | - |
Tri a 19 | Tri a 19.0101 | QSPEQQQ | Sequential / Linear | 380-386 | - | 52395 | IgE from serum of patients with WDEIA | - | - | - | ELISA | 16128812 | - |
Tri a 19 | Tri a 19.0101 | YQQYPQQ | Sequential / Linear | 420-426 | - | 75541 | IgE from serum of patients with WDEIA | - | - | - | ELISA | 16128812 | - |
Tri a 33 | Tri a 33B | HVALSLITAGAGGATRNQLAATL | Sequential / Linear | 46-68 | - | 177507 | IgE from serum of patients with food allergy to wheat and Baker's asthma | - | - | - | Western / Immunoblot | 23109467 | - |
Tri a 33 | Tri a 33B | LHALAEQVVQFVLADA | Sequential / Linear | 76-91 | - | 177517 | IgE from serum of patients with food allergy to wheat and Baker's asthma | - | - | - | Western / Immunoblot | 23109467 | - |
Tri a 33 | Tri a 33B | HIPRQKVALRQFKLPKFKISLGI | Sequential / Linear | 271-293 | - | 177505 | IgE from serum of patients with food allergy to wheat and Baker's asthma | - | - | - | Western / Immunoblot | 23109467 | - |
Tri a 33 | Tri a 33B | VLDFIVDHPFLFLIREDTSGV | Sequential / Linear | 364-384 | - | 177554 | IgE from serum of patients with food allergy to wheat and Baker's asthma | - | - | - | Western / Immunoblot | 23109467 | - |
Tri a 37 | Tri a 37.0101 | KSCCRSTLGRNCYNLCRARGAQKLCAGVCR | Sequential / Linear | 28-57 | - | 233645 | IgE from serum of wheat-allergic patients | - | - | - | Western / Immunoblot | 25368998 | - |
Tri a 37 | Tri a 37.0101 | KGFPKLALESNSDEPDTIEYCNLGCRSSVC | Sequential / Linear | 68-97 | - | 233634 | IgE from serum of wheat-allergic patients | - | - | - | Western / Immunoblot | 25368998 | - |
Tri a 37 | Tri a 37.0101 | CNLGCRSSVCDYMVNAAADDEEMKLYVEN | Sequential / Linear | 88-116 | - | 233452 | IgE from serum of wheat-allergic patients | - | - | - | Western / Immunoblot | 25368998 | - |
Ziz m 1 | Ziz m 1.0101 | NISGHCSDCTFLGEE | Sequential / Linear | 72-86 | - | 44339 | IgE from serum of latex-Indian jujube-allergic patients | - | - | Major epitope | ELISA | 18435802 | - |
Ziz m 1 | Ziz m 1.0101 | VWNRYYDLKT | Sequential / Linear | 292-301 | - | 71955 | IgE from serum of latex-Indian jujube-allergic patients | - | - | Major epitope | ELISA | 18435802 | - |
Ziz m 1 | Ziz m 1.0101 | KTNYSSSIILEY | Sequential / Linear | 300-311 | - | 33803 | IgE from serum of latex-Indian jujube-allergic patients | - | - | Major epitope | ELISA | 18435802 | - |
Ziz m 1 | Ziz m 1.0101 | LEYVNSGTKYLP | Sequential / Linear | 309-320 | - | 35780 | IgE from serum of latex-Indian jujube-allergic patients | - | - | Major epitope | ELISA | 18435802 | - |