![]() |
Database of 2256 Experimentally Validated Allergens |
![]() |
![]() |
Database of 2256 Experimentally Validated Allergens |
AllerBase ID | AB_P_00636 | Allergen Name | Cyn d 1 |
Source Organism | Cynodon dactylon (Bermuda grass) | Kingdom | Plant |
Biological Function/Role | Expansin | Mode of Exposure | Inhalation |
Biological assay / test | IgE assay / test | Physicochemical test | Cell-based assay |
Basophil/Mast cell/Histamine Test ![]() | EAST ![]() | Chromatography ![]() | Lymphocyte proliferation assay ![]() |
Bronchial Test ![]() | ELISA ![]() | Isoelectrofocusing ![]() | |
Conjunctival Test ![]() | Crossed immunoelectrophoresis ![]() | Mass spectrometry (MS) ![]() | |
Nasal Test ![]() | Fluorescence Immunoassay ![]() | N-terminal sequencing/sequence analysis ![]() | |
Oral Test ![]() | Immunochemiluminescent assay ![]() | ||
Passive Cutaneous Anaphylaxis (PCA) ![]() | ImmunoCAP Test ![]() | ||
Skin Test ![]() | Microarray ![]() | ||
Radio Immunoassay ![]() | |||
RAST ![]() | |||
Western/Immunoblot ![]() |
Isoallergen/Variant for Cyn d 1: | Available |
Isoallergen/Variant | Common Name | GenBank Nucleotide | NCBI Protein (GenPept) | UniProtKB | RCSB-PDB (Click on the PDB id to view structure) | ETR (Evolutionary Trace analysis Report) |
Cyn d 1.0101 | Major pollen allergen Cyn d 1 | |||||
Cyn d 1.0102 | Major pollen allergen Cyn d 1 | |||||
Cyn d 1.0103 | Major pollen allergen Cyn d 1 | |||||
Cyn d 1.0104 | Major pollen allergen Cyn d 1 | |||||
Cyn d 1.0105 | Major pollen allergen Cyn d 1 | |||||
Cyn d 1.0106 | Major pollen allergen Cyn d 1 | |||||
Cyn d 1.0107 | Major pollen allergen Cyn d 1 | |||||
Cyn d 1.0201 | Acidic allergen Cyn d 1 | |||||
Cyn d 1.0202 | Acidic Cyn d 1 isoallergen isoform 2 | |||||
Cyn d 1.0203 | Acidic Cyn d 1 isoallergen isoform 4 | |||||
Cyn d 1.0204 | Acidic Cyn d 1 isoallergen isoform 1 |
|
IUIS | IUIS-Allergen |
Allergome | 266 |
AllFam | AF093 |
Allergen | Isoallergen / Isoform | Epitope | Type of Epitope | Sequence Position | View on Structure | IEDB | Antibody Used | IMGT | AgAbDb Link | Nature of Epitope | Assay | Reference | Comment |
Cyn d 1 | Cyn d 1.0201 | QDDVIPEDWKPDTVYKSKIQF | Sequential / Linear | 224-244 | - | 104948 | IgE from serum of Bermuda grass pollen allergic patients | - | - | Major epitope | Immunoblot and ELISA | 19187539 | - |
Cyn d 1 | Cyn d 1.0201 | EEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAG | Sequential / Linear | 121-170 | - | 104761 | IgE from serum of Bermuda grass pollen allergic patients | - | - | Major epitope | Immunoblot and ELISA | 19187539 | - |
Cyn d 1 | Cyn d 1.0101 | CRACYEIKCK | Sequential / Linear | 70-79 | - | 174069 | IgE from serum of Bermuda grass pollen allergic patients | - | - | Major epitope | Western / Immunoblot | 21985791 | - |
Cyn d 1 | Cyn d 1.0101 | IAAYHFDLSG | Sequential / Linear | 101-110 | - | 174146 | IgE from serum of Bermuda grass pollen allergic patients | - | - | Major epitope | Western / Immunoblot | 21985791 | - |
Cyn d 1 | Cyn d 1.0101 | HYLALLVKY | Sequential / Linear | 159-167 | - | 174145 | IgE from serum of Bermuda grass pollen allergic patients | - | - | Major epitope | Western / Immunoblot | 21985791 | - |
Cyn d 1 | Cyn d 1.0101 | GNIVAVDIKP | Sequential / Linear | 172-181 | - | 174123 | IgE from serum of Bermuda grass pollen allergic patients | - | - | Major epitope | Western / Immunoblot | 21985791 | - |
No IgE Antibody Data Available |
Allergen | Cross-reactive Allergens | Reference |
Cyn d 1 | Lol p 1 (View AllerBase Entry) | 19776679 |
Cyn d 1 | Sor h 1 (View AllerBase Entry) Uro mu 1 (View AllerBase Entry) | 29549697 |
Cyn d 1 | Zoy m 1 (View AllerBase Entry) | 34246219 |
Cyn d 1 | Lol p 1 (View AllerBase Entry) Ory s 1 (View AllerBase Entry) | 7590339 |