![]() |
Database of 2256 Experimentally Validated Allergens |
![]() |
![]() |
Database of 2256 Experimentally Validated Allergens |
AllerBase ID | AB_P_00291 | Allergen Name | Bet v 2 |
Source Organism | Betula pendula (European white birch) | Kingdom | Plant |
Biological Function/Role | Actin-binding protein | Mode of Exposure | Inhalation |
Biological assay / test | IgE assay / test | Physicochemical test | Cell-based assay |
Basophil/Mast cell/Histamine Test ![]() | EAST ![]() | Chromatography ![]() | Lymphocyte proliferation assay ![]() |
Bronchial Test ![]() | ELISA ![]() | Isoelectrofocusing ![]() | |
Conjunctival Test ![]() | Crossed immunoelectrophoresis ![]() | Mass spectrometry (MS) ![]() | |
Nasal Test ![]() | Fluorescence Immunoassay ![]() | N-terminal sequencing/sequence analysis ![]() | |
Oral Test ![]() | Immunochemiluminescent assay ![]() | ||
Passive Cutaneous Anaphylaxis (PCA) ![]() | ImmunoCAP Test ![]() | ||
Skin Test ![]() | Microarray ![]() | ||
Radio Immunoassay ![]() | |||
RAST ![]() | |||
Western/Immunoblot ![]() |
Isoallergen/Variant for Bet v 2: | Available |
Isoallergen/Variant | Common Name | GenBank Nucleotide | NCBI Protein (GenPept) | UniProtKB | RCSB-PDB (Click on the PDB id to view structure) | ETR (Evolutionary Trace analysis Report) |
Bet v 2.0101 | Profilin-1 |
|
IUIS | IUIS-Allergen |
Allergome | 127 |
AllFam | AF051 |
Allergen | Isoallergen / Isoform | Epitope | Type of Epitope | Sequence Position | View on Structure | IEDB | Antibody Used | IMGT | AgAbDb Link | Nature of Epitope | Assay | Reference | Comment |
Bet v 2 | Bet v 2.0101 | PQFKPQ | Sequential / Linear | 42-47 | 1CQA | 48996 | Monoclonal antibody 4A6 | IMGT/3Dstructure-DB | - | - | Western blot | 8939935 | Monoclonal antibody from Mouse |
Bet v 2 | Bet v 2.0101 | MSWQTYVDEHLMCDIDGQGEELAASAIVGHDG | Sequential / Linear | 1-32 | - | 78467 | IgE from serum of profilin-allergic patients | - | - | Major epitope | Phage display / Immunopanning | 9016715 | - |
Bet v 2 | Bet v 2.0101 | VGHDGSVWAQSSSFPQFKPQ | Sequential / Linear | 28-47 | 1CQA | 78553 | IgE from serum of profilin-allergic patients | - | - | Major epitope | Phage display / Immunopanning | 9016715 | - |
Bet v 2 | Bet v 2.0101 | VWAQSSSFPQFKPQE | Sequential / Linear | 34-48 | 1CQA | 78561 | IgE from serum of profilin-allergic patients | - | - | Major epitope | Phage display / Immunopanning | 9016715 | - |
Bet v 2 | Bet v 2.0101 | AQSSSFPQFKPQEITGI | Sequential / Linear | 36-52 | 1CQA | 78351 | IgE from serum of profilin-allergic patients | - | - | Major epitope | Phage display / Immunopanning | 9016715 | - |
Bet v 2 | Bet v 2.0101 | IYEEPVTPGQCNMVVERLGDYLIDQGL | Sequential / Linear | 107-133 | 1CQA | 78427 | IgE from serum of profilin-allergic patients | - | - | Major epitope | Phage display / Immunopanning | 9016715 | - |
Antibody data | Allergen data |
Antibody/ Chain Description | Clone/ Isolate | Antibody Source | IMGT | NCBI Protein (GenPept) | Broad Allergen Category | Allergen Id /Name | Material used for Sensitization | Allergic Disease | Antibody studied in | Reference |
Monoclonal antibody 4A6, heavy chain | - | Mus musculus | Y08364 | - | Respiratory | Bet v 2 | Birch profilin | Not specified | Not specified | 8939935 |
Monoclonal antibody 4A6, light chain | - | Mus musculus | Y08365 | CAA69651.1 | Respiratory | Bet v 2 | Birch profilin | Not specified | Not specified | 8939935 |