Biological assay / test |
IgE assay / test |
Physicochemical test |
Cell-based assay |
Basophil/Mast cell/Histamine Test  | EAST  | Chromatography (Reference/s) | Lymphocyte proliferation assay  |
Bronchial Test  | ELISA (Reference/s) | Isoelectrofocusing  | |
Conjunctival Test  | Crossed immunoelectrophoresis  | Mass spectrometry (MS) (Reference/s) | |
Nasal Test  | Fluorescence Immunoassay  | N-terminal sequencing/sequence analysis (Reference/s) | |
Oral Test  | Immunochemiluminescent assay  | | |
Passive Cutaneous Anaphylaxis (PCA)  | ImmunoCAP Test (Reference/s) | | |
Skin Test  | Microarray (Reference/s) | | |
| Radio Immunoassay  | | |
| RAST  | | |
| Western/Immunoblot (Reference/s) | | |
Allergen |
Isoallergen / Isoform |
Epitope |
Type of Epitope |
Sequence Position |
View on Structure |
IEDB |
Antibody Used |
IMGT |
AgAbDb Link |
Nature of Epitope |
Assay |
Reference |
Comment |
Len c 1 | Len c 1.0101 | EEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAIN | Sequential / Linear | 313-348 | - | 141631 | IgE from serum of Lentil allergic patients | - | - | - | Fluorescence immuno assay | 20816193 | - |
Len c 1 | Len c 1.0101 | PAGHPVAINASSDLNLIGFGINAKNNQ | Sequential / Linear | 340-366 | - | 141721 | IgE from serum of Lentil allergic patients | - | - | - | Fluorescence immuno assay | 20816193 | - |
Len c 1 | Len c 1.0101 | LIGFGINAKNNQRNFLAGEEDNVIS | Sequential / Linear | 355-379 | - | 141700 | IgE from serum of Lentil allergic patients | - | - | - | Fluorescence immuno assay | 20816193 | - |
Len c 1 | Len c 1.0101 | EEDNVISQIQRPVKELAFPGSSREVDR | Sequential / Linear | 373-399 | - | 141628 | IgE from serum of Lentil allergic patients | - | - | - | Fluorescence immuno assay | 20816193 | - |