Biological assay / test |
IgE assay / test |
Physicochemical test |
Cell-based assay |
Basophil/Mast cell/Histamine Test (Reference/s) | EAST  | Chromatography (Reference/s) | Lymphocyte proliferation assay  |
Bronchial Test  | ELISA (Reference/s) | Isoelectrofocusing  | |
Conjunctival Test  | Crossed immunoelectrophoresis  | Mass spectrometry (MS) (Reference/s) | |
Nasal Test  | Fluorescence Immunoassay  | N-terminal sequencing/sequence analysis  | |
Oral Test  | Immunochemiluminescent assay  | | |
Passive Cutaneous Anaphylaxis (PCA)  | ImmunoCAP Test (Reference/s) | | |
Skin Test  | Microarray  | | |
| Radio Immunoassay  | | |
| RAST  | | |
| Western/Immunoblot (Reference/s) | | |
Allergen |
Isoallergen / Isoform |
Epitope |
Type of Epitope |
Sequence Position |
View on Structure |
IEDB |
Antibody Used |
IMGT |
AgAbDb Link |
Nature of Epitope |
Assay |
Reference |
Comment |
Ses i 6 | Ses i 6.0101 | QTREPRLTQGQQCRFQRISGAQPSLRI | Sequential / Linear | 22-48 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | QFQCAGIVAMRSTIRPNGLSLPNY | Sequential / Linear | 64-87 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | GCAETYQVHRSQRTMERTEASEQQDRGSVRDLHQKVHRLRQG | Sequential / Linear | 109-150 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | DVNHLSNQLDQKFRAFYLAGGVPRSGEQEQQARQTF | Sequential / Linear | 178-213 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | GLIVMARERMTFVRP | Sequential / Linear | 247-261 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | NGLEETFCTMKFRTN | Sequential / Linear | 277-291 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | FSRQAGRVHVVDRNKLPILKYMDL | Sequential / Linear | 301-324 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | PDWSMTGHTIVYVTRG | Sequential / Linear | 349-354 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | GEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMP | Sequential / Linear | 375-423 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |
Ses i 6 | Ses i 6.0101 | ISPNQAQALKMNRGSQSFLLSPGGRRS | Sequential / Linear | 433-459 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 2 |