![]() |
Database of 2313 Experimentally Validated Allergens |
![]() |
![]() |
Database of 2313 Experimentally Validated Allergens |
AllerBase ID | AB_F_01596 | Allergen Name | Rhi o 2 |
Source Organism | Rhizopus oryzae () | Kingdom | Fungi |
Biological Function/Role | Cyclophilin | Mode of Exposure | Inhalation |
Biological assay / test | IgE assay / test | Physicochemical test | Cell-based assay |
Basophil/Mast cell/Histamine Test ![]() | EAST ![]() | Chromatography ![]() | Lymphocyte proliferation assay ![]() |
Bronchial Test ![]() | ELISA ![]() | Isoelectrofocusing ![]() | |
Conjunctival Test ![]() | Crossed immunoelectrophoresis ![]() | Mass spectrometry (MS) ![]() | |
Nasal Test ![]() | Fluorescence Immunoassay ![]() | N-terminal sequencing/sequence analysis ![]() | |
Oral Test ![]() | Immunochemiluminescent assay ![]() | ||
Passive Cutaneous Anaphylaxis (PCA) ![]() | ImmunoCAP Test ![]() | ||
Skin Test ![]() | Microarray ![]() | ||
Radio Immunoassay ![]() | |||
RAST ![]() | |||
Western/Immunoblot ![]() |
Isoallergen/Variant for Rhi o 2: | Available |
Isoallergen/Variant | Common Name | GenBank Nucleotide | NCBI Protein (GenPept) | UniProtKB | RCSB-PDB (Click on the PDB id to view structure) | ETR (Evolutionary Trace analysis Report) |
Rhi o 2.0101 | Cyclophilin A |
|
IUIS | IUIS-Allergen |
Allergome | 11935 |
AllFam | AF038 |
Allergen | Isoallergen / Isoform | Epitope | Type of Epitope | Sequence Position | View on Structure | IEDB | Antibody Used | IMGT | AgAbDb Link | Nature of Epitope | Assay | Reference | Comment |
Rhi o 2 | Rhi o 2.0101 | NKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFITTIKCSWLDGKHVVFGRVTEGMDVVQNIESLGSPN | Sequential / Linear | 81-149 | - | - | Sera from patients with fungal | - | - | - | Immunoblot, Mutagenesis | 31882546 | Fragment contaning site of IgE recognition and cross-reactivity |
No IgE Antibody Data Available |
Allergen | Cross-reactive Allergens | Reference |
Rhi o 2 | Asp f 11 (View AllerBase Entry) Asp f 27 (View AllerBase Entry) Mala s 6 (View AllerBase Entry) Hom s CYPA (View AllerBase Entry) | 31882546 |