Allergen |
Isoallergen / Isoform |
Epitope |
Type of Epitope |
Sequence Position |
View on Structure |
IEDB |
Antibody Used |
IMGT |
AgAbDb Link |
Nature of Epitope |
Assay |
Reference |
Comment |
Pis v 2 | Pis v 2 | SEAGVTEFWDQNEEQLQC | Sequential / Linear | 59-76 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | QGSGIHGAVFPGCPETFQEES | Sequential / Linear | 107-127 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | EQHQKVRHIREGDIIALPAGV | Sequential / Linear | 146-166 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | NGQSKLVLVALADVGNSE | Sequential / Linear | 173-190 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | FVLGGSPQQEIQGGGQSW | Sequential / Linear | 200-217 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | RSSRKGQQSNNILSAFDE | Sequential / Linear | 221-238 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | KEDLQVLSPQRQEKEYSDNGLEETFCT | Sequential / Linear | 269-295 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | SIVYITRGNGRMQIVSENGESVFDEEIREGQLV | Sequential / Linear | 357-389 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | QNFAVVKRASSDGFEWVS | Sequential / Linear | 393-410 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |
Pis v 2 | Pis v 2 | ISVMRGLPLDVIQNSFDISREDAWNLKESRSEMTIF | Sequential / Linear | 426-461 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | - |