![]() |
Database of 2313 Experimentally Validated Allergens |
![]() |
![]() |
Database of 2313 Experimentally Validated Allergens |
AllerBase ID | AB_A_01348 | Allergen Name | Pen a 1 |
Source Organism | Penaeus aztecus (Brown shrimp) | Kingdom | Animal |
Biological Function/Role | Muscle contraction protein | Mode of Exposure | Ingestion |
Biological assay / test | IgE assay / test | Physicochemical test | Cell-based assay |
Basophil/Mast cell/Histamine Test ![]() | EAST ![]() | Chromatography ![]() | Lymphocyte proliferation assay ![]() |
Bronchial Test ![]() | ELISA ![]() | Isoelectrofocusing ![]() | |
Conjunctival Test ![]() | Crossed immunoelectrophoresis ![]() | Mass spectrometry (MS) ![]() | |
Nasal Test ![]() | Fluorescence Immunoassay ![]() | N-terminal sequencing/sequence analysis ![]() | |
Oral Test ![]() | Immunochemiluminescent assay ![]() | ||
Passive Cutaneous Anaphylaxis (PCA) ![]() | ImmunoCAP Test ![]() | ||
Skin Test ![]() | Microarray ![]() | ||
Radio Immunoassay ![]() | |||
RAST ![]() | |||
Western/Immunoblot ![]() |
Isoallergen/Variant for Pen a 1: | Available |
Isoallergen/Variant | Common Name | GenBank Nucleotide | NCBI Protein (GenPept) | UniProtKB | RCSB-PDB (Click on the PDB id to view structure) | ETR (Evolutionary Trace analysis Report) |
Pen a 1.0101 | Tropomyosin |
|
IUIS | IUIS-Allergen |
Allergome | 515 |
AllFam | AF054 |
Allergen | Isoallergen / Isoform | Epitope | Type of Epitope | Sequence Position | View on Structure | IEDB | Antibody Used | IMGT | AgAbDb Link | Nature of Epitope | Assay | Reference | Comment |
Pen a 1 | Pen a 1.0101 | AADESERMRKVLENRSLSDEERMDALENQL | Sequential / Linear | 119-148 | - | - | IgE from serum of shrimp-allergic patients | - | - | Major epitope | Western / Immunoblot | 10224419 | - |
Pen a 1 | Pen a 1.0101 | FLAEEADRKYDEVARKLAMVEADLERA | Sequential / Linear | 153-179 | - | - | IgE from serum of shrimp-allergic patients | - | - | Major epitope | Western / Immunoblot | 10224419 | - |
Pen a 1 | Pen a 1.0101 | FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS | Sequential / Linear | 241-282 | - | - | IgE from serum of shrimp-allergic patients | - | - | Major epitope | Western / Immunoblot | 10224419 | - |
No IgE Antibody Data Available |
Allergen | Cross-reactive Allergens | Reference |
Pen a 1 | Hom a 1 (View AllerBase Entry) Der f 10 (View AllerBase Entry) Der p 10 (View AllerBase Entry) Per a 7 (View AllerBase Entry) | 12372997 |
Pen a 1 | Lep s 1 (View AllerBase Entry) Per a 7 (View AllerBase Entry) Der p 10 (View AllerBase Entry) | 15836758 |
Pen a 1 | Cha f 1 (View AllerBase Entry) Hom a 1 (View AllerBase Entry) Eup p Trp (View AllerBase Entry) Eup s 1 (View AllerBase Entry) | 17912005 |
Pen a 1 | Der p 10 (View AllerBase Entry) | 31467382 |
Pen a 1 | Der p 10 (View AllerBase Entry) | 31685384 |