![]() |
Database of 2313 Experimentally Validated Allergens |
![]() |
![]() |
Database of 2313 Experimentally Validated Allergens |
AllerBase ID | AB_A_02219 | Allergen Name | Lit v 13 |
Source Organism | Litopenaeus vannamei (Whiteleg shrimp) | Kingdom | Animal |
Biological Function/Role | Fatty-acid binding protein | Mode of Exposure | Ingestion |
Biological assay / test | IgE assay / test | Physicochemical test | Cell-based assay |
Basophil/Mast cell/Histamine Test ![]() | EAST ![]() | Chromatography ![]() | Lymphocyte proliferation assay ![]() |
Bronchial Test ![]() | ELISA ![]() | Isoelectrofocusing ![]() | |
Conjunctival Test ![]() | Crossed immunoelectrophoresis ![]() | Mass spectrometry (MS) ![]() | |
Nasal Test ![]() | Fluorescence Immunoassay ![]() | N-terminal sequencing/sequence analysis ![]() | |
Oral Test ![]() | Immunochemiluminescent assay ![]() | ||
Passive Cutaneous Anaphylaxis (PCA) ![]() | ImmunoCAP Test ![]() | ||
Skin Test ![]() | Microarray ![]() | ||
Radio Immunoassay ![]() | |||
RAST ![]() | |||
Western/Immunoblot ![]() |
Isoallergen/Variant for Lit v 13: | Available |
Isoallergen/Variant | Common Name | GenBank Nucleotide | NCBI Protein (GenPept) | UniProtKB | RCSB-PDB (Click on the PDB id to view structure) | ETR (Evolutionary Trace analysis Report) |
Lit v 13.0101 | Fatty-acid binding protein |
|
IUIS | IUIS-Allergen |
Allergome | - |
AllFam | - |
Allergen | Isoallergen / Isoform | Epitope | Type of Epitope | Sequence Position | View on Structure | IEDB | Antibody Used | IMGT | AgAbDb Link | Nature of Epitope | Assay | Reference | Comment |
Lit v 13 | Lit v 13.0101 | VEITKDGDTYTMKTTTTFKTTEIKFKLGEEFEETTADGRVVKSTIT | Sequential / Linear | 40-85 | - | 1642076 | Sera from shrimp-allergic patients | - | - | - | ELISA | 34695231 | - |
Lit v 13 | Lit v 13.0101 | ELLREFTDDKMLMECKVDDVVCKRVYSRLE | Sequential / Linear | 107-136 | - | - | Sera from shrimp-allergic patients | - | - | - | ELISA | 34695231 | - |
Lit v 13 | Lit v 13.0101 | TTTTFKTTEIKFKLGEEFEE | Sequential / Linear | 53-72 | - | - | Sera from shrimp allergic patients sensitized to FABP | - | - | - | ELISA | DOI:10.22541/au.161857969.92060255/v1 | Epitope mediating cross-reactivity with Blo t 13 |
No IgE Antibody Data Available |
Allergen | Cross-reactive Allergens | Reference |
Lit v 13 | Blo t 13 (View AllerBase Entry) | 34695231 |
Lit v 13 | Blo t 13 (View AllerBase Entry) | 34695231 |
Lit v 13 | Blo t 13 (View AllerBase Entry) | DOI:10.22541/au.161857969.92060255/v1 |