AllerBase Allergen Database

Data for Lit v 1

WHO/IUIS recognized Allergen

1 1 1 1 1 0 1 0 1

Completeness Index: Denotes availibility of data for the allergen in Binary format
1: data available
0: data not available

(Read More)

Download data as Text file

AllerBase ID	AB_A_01113	Allergen Name	Lit v 1
Source Organism	Litopenaeus vannamei (Whiteleg shrimp)	Kingdom	Animal
Biological Function/Role	Muscle contraction protein	Mode of Exposure	Ingestion

Assays/Methods used for Experimental Characterization (Read More)

: Data Available

: Data not Available

Biological assay / test	IgE assay / test	Physicochemical test	Cell-based assay
Basophil/Mast cell/Histamine Test (Reference/s)	EAST	Chromatography (Reference/s)	Lymphocyte proliferation assay (Reference/s)
Bronchial Test	ELISA (Reference/s)	Isoelectrofocusing
Conjunctival Test	Crossed immunoelectrophoresis	Mass spectrometry (MS) (Reference/s)
Nasal Test	Fluorescence Immunoassay	N-terminal sequencing/sequence analysis
Oral Test	Immunochemiluminescent assay
Passive Cutaneous Anaphylaxis (PCA)	ImmunoCAP Test
Skin Test	Microarray (Reference/s)
	Radio Immunoassay
	RAST
	Western/Immunoblot (Reference/s)

Isoallergen/Variant for Lit v 1:

Available

Isoallergen/Variant	Common Name	GenBank Nucleotide	NCBI Protein (GenPept)	UniProtKB	RCSB-PDB (Click on the PDB id to view structure)	ETR (Evolutionary Trace analysis Report)
Lit v 1.0101	Tropomyosin	EU410072.1 (View Sequence)	ACB38288.1 (View Sequence)	B4YAH6 (View Sequence)	-	-

Sequence Analysis

BLAST
Pairwise alignment
Hide Tab

BLAST Nucleotide/Protein sequence of Allergen Lit v 1 with Nucleotide or Protein sequences in AllerBase:
Select GenBank or UniprotKB accession number by clicking on the checkbox in the above table

Default E-value cut-off for BLAST is set at 0.01.

OR
Set E-value of your choice:
Align Nucleotode/Protein sequence of Your choice with Nucleotode or Protein sequence of Allergen Lit v 1: (Alignment job will be redirected to EMBL-EMBOSS Water or Needle tool)

*

*Input your Nucleotode or Protein sequence (in FASTA format) here:

Cross-links to Allergen Databases

IUIS	IUIS-Allergen
Allergome	4029
AllFam	AF054

IgE Epitope Data

Allergen	Isoallergen / Isoform	Epitope	Type of Epitope	Sequence Position	View on Structure	IEDB	Antibody Used	IMGT	AgAbDb Link	Nature of Epitope	Assay	Reference	Comment
Lit v 1	Lit v 1.0101	MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRA	Sequential / Linear	1-36	-	41215	IgE from serum of Shrimp allergic patients	-	-	-	Microarray	20471069	-
Lit v 1	Lit v 1.0101	EKSEEEVHNLQKRMQQLENDLDQVQES	Sequential / Linear	37-63	-	12871	IgE from serum of Shrimp allergic patients	-	-	-	Microarray	20471069	-
Lit v 1	Lit v 1.0101	QESLLKANIQLVEKDKALSNA	Sequential / Linear	61-81	-	50696	IgE from serum of Shrimp allergic patients	-	-	-	Microarray	20471069	-
Lit v 1	Lit v 1.0101	EGEVAALNRRIQLLEEDLERSEER	Sequential / Linear	82-105	-	116700	IgE from serum of Shrimp allergic patients	-	-	-	Microarray	20471069	-
Lit v 1	Lit v 1.0101	ASQAADESERMRKVLENRSLSDEERMDALENQLKE	Sequential / Linear	115-150	-	11190	IgE from serum of Shrimp allergic patients	-	-	-	Microarray	20471069	-
Lit v 1	Lit v 1.0101	ALENQLKEARFLAEEADRKY	Sequential / Linear	142-162	-	116689	IgE from serum of Shrimp allergic patients	-	-	-	Microarray	20471069	-
Lit v 1	Lit v 1.0101	EADRKYDEVARKLAMVEADLERAEERA	Sequential / Linear	157-183	-	11011	IgE from serum of Shrimp allergic patients	-	-	-	Microarray	20471069	-
Lit v 1	Lit v 1.0101	IVELEEELRVVGNNLKSLEVS	Sequential / Linear	190-210	-	116755	IgE from serum of Shrimp allergic patients	-	-	-	Microarray	20471069	-
Lit v 1	Lit v 1.0101	VQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY	Sequential / Linear	246-284	-	116824	IgE from serum of Shrimp allergic patients	-	-	-	Microarray	20471069	-
Lit v 1	Lit v 1.0101	QKRMQQLENDLDQVQ	Sequential / Linear	47-61	-	1087239	IgE from serum of Shrimp allergic patients	-	-	-	Dot blot, ELISA, Mediator release	32334299	-
Lit v 1	Lit v 1.0101	EDLERSEERLNT	Sequential / Linear	97-108	-	1087203	IgE from serum of Shrimp allergic patients	-	-	-	Dot blot, ELISA, Mediator release	32334299	-
Lit v 1	Lit v 1.0101	RSVQKLQKEVDRLE	Sequential / Linear	244-257	-	1087243	IgE from serum of Shrimp allergic patients	-	-	-	Dot blot, ELISA, Mediator release	32334299	-

IgE Antibody Data

No IgE Antibody Data Available

Cross-reactivity Data

Allergen	Cross-reactive Allergens	Reference
Lit v 1	Aed a 10 (View AllerBase Entry) Asc l 3 (View AllerBase Entry) Blo t 10 (View AllerBase Entry) Der p 10 (View AllerBase Entry)	27355916
Lit v 1	Ven ph Trp (View AllerBase Entry) Lar c Trp (View AllerBase Entry)	32334299
Lit v 1	Cra a Trp (View AllerBase Entry) Hal di Trp (View AllerBase Entry) Chla n Trp (View AllerBase Entry) Pat y Trp (View AllerBase Entry) Ven ph Trp (View AllerBase Entry) Sol st Trp (View AllerBase Entry) Cra g 1 (View AllerBase Entry) Scy p 1 (View AllerBase Entry)	35848932
Lit v 1	Aed a 10 (View AllerBase Entry) Pen m 1 (View AllerBase Entry)	DOI:10.1016/j.jaci.2013.12.378
Lit v 1	Squ o Trp (View AllerBase Entry) Scy s Trp (View AllerBase Entry) Ven ph Trp (View AllerBase Entry)	DOI:10.3724/SP.J.1231.2010.06607