Allergen |
Isoallergen / Isoform |
Epitope |
Type of Epitope |
Sequence Position |
View on Structure |
IEDB |
Antibody Used |
IMGT |
AgAbDb Link |
Nature of Epitope |
Assay |
Reference |
Comment |
Gly m 6 | Gly m 6.0201 | KLVLSLCFLLFSGCF | Sequential / Linear | 3-17 | - | 32233 | IgE from serum of soybean allergic patients | - | - | - | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | NGPQEIYIQQGNGIF | Sequential / Linear | 83-97 | - | 44051 | IgE from serum of soybean allergic patients | - | - | Immunodominant epitope | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | QQGNGIFGMIFPGCP | Sequential / Linear | 90-104 | - | 52031 | IgE from serum of soybean allergic patients | - | - | - | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | RFYLAGNQEQEFLKY | Sequential / Linear | 177-191 | - | 53810 | IgE from serum of soybean allergic patients | - | - | Immunodominant epitope | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | LKYQQQQQGGSQSQK | Sequential / Linear | 189-203 | - | 37068 | IgE from serum of soybean allergic patients | - | - | - | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | VKGGLRVTAPAMRKP | Sequential / Linear | 255-269 | - | 69226 | IgE from serum of soybean allergic patients | - | - | - | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | LDFPALWLLKLSAQY | Sequential / Linear | 337-351 | - | 35160 | IgE from serum of soybean allergic patients | - | - | - | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | LKLSAQYGSLRKNAM | Sequential / Linear | 345-359 | - | 36948 | IgE from serum of soybean allergic patients | - | - | Immunodominant epitope | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | MFVPHYTLNANSIIY | Sequential / Linear | 358-372 | - | 41548 | IgE from serum of soybean allergic patients | - | - | - | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | NANSIIYALNGRALV | Sequential / Linear | 367-381 | - | 43262 | IgE from serum of soybean allergic patients | - | - | - | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0201 | QHTFNLKSQQARQVK | Sequential / Linear | 469-475 | - | 51031 | IgE from serum of soybean allergic patients | - | - | Immunodominant epitope | Western / Immunoblot and structural model | 11112857 | - |
Gly m 6 | Gly m 6.0101 | GGSILSGFTLEFLEHAFSV | Sequential / Linear | 217-235 | 1FXZ 1UCX 1UD1
|
( ! ) Deprecated: Function split() is deprecated in C:\wamp\www\AllerBase\PHP_codes\allergen.php on line 1852 |
Call Stack |
# | Time | Memory | Function | Location |
1 | 0.0020 | 1223040 | {main}( ) | ..\allergen.php:0 |
20021 19632
| IgE from pooled serum of soy-allergic patient | - | - | - | Western / Immunoblot | 11146387 | Ara h 3 homologous epitope |
Gly m 6 | Gly m 6.0101 | GAIVTVKGGLSVI | Sequential / Linear | 253-265 | 1FXZ 1UCX 1UD1
| 18633 | IgE from pooled serum of soy-allergic patient | - | - | - | Western / Immunoblot | 11146387 | Ara h 3 homologous epitope |
Gly m 6 | Gly m 6.0201 | SGFAPEFLKEAFGVN | Sequential / Linear | 219-233 | - | 58026 | IgE from pooled serum of soybean and peanut-allergic patient | - | - | Immunodominant epitope | Western / Immunoblot and structural model | 12485602 | - |
Gly m 6 | Gly m 6.0201 | AIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVE | Sequential / Linear | 251-286 | - | - | IgE from serum of allergic patients | - | - | Immunodominant epitope | ELISA | 36335553 | - |