Biological assay / test |
IgE assay / test |
Physicochemical test |
Cell-based assay |
Basophil/Mast cell/Histamine Test (Reference/s) | EAST  | Chromatography (Reference/s) | Lymphocyte proliferation assay  |
Bronchial Test  | ELISA (Reference/s) | Isoelectrofocusing  | |
Conjunctival Test  | Crossed immunoelectrophoresis  | Mass spectrometry (MS) (Reference/s) | |
Nasal Test  | Fluorescence Immunoassay (Reference/s) | N-terminal sequencing/sequence analysis  | |
Oral Test  | Immunochemiluminescent assay  | | |
Passive Cutaneous Anaphylaxis (PCA) (Reference/s) | ImmunoCAP Test (Reference/s) | | |
Skin Test  | Microarray (Reference/s) | | |
| Radio Immunoassay  | | |
| RAST  | | |
| Western/Immunoblot (Reference/s) | | |
Allergen |
Isoallergen / Isoform |
Epitope |
Type of Epitope |
Sequence Position |
View on Structure |
IEDB |
Antibody Used |
IMGT |
AgAbDb Link |
Nature of Epitope |
Assay |
Reference |
Comment |
Gly m 5 | Gly m 5.0101 | ECEEGEIPRPRPRPQHPEREPQQPGEKEE | Sequential / Linear | 5-33 | - | 181299 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | HEQREEQEWPRKEEKRGEKGSEEEDE | Sequential / Linear | 55-80 | - | 181334 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | QFPFPRPPHQKEERKQEEDEDEEQQR | Sequential / Linear | 90-115 | - | 181432 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | DEEQQRESEESEDSELRRHKNKNPFL | Sequential / Linear | 110-135 | - | 181288 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | NKNPFLFGSNRFETLFKNQYGRIRVLQRF | Sequential / Linear | 130-158 | - | 181406 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | TAILSLVNNDDRDSYRLQSGDALRVPSGT | Sequential / Linear | 200-229 | - | 181474 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | YYVVNPDNNENLRLITLAIPVNKPGRFES | Sequential / Linear | 230-260 | - | 181524 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | EQIRALSKRAKSSSRKTISSEDKPFN | Sequential / Linear | 320-345 | - | 181307 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | SEDKPFNLRSRDPIYSNKLGKFFEITPEKN | Sequential / Linear | 338-368 | - | 181455 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | DPIYSNKLGKFFEITPEKNPQLRDLD | Sequential / Linear | 350-375 | - | 181292 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | QRESYFVDAQPKKKEEGNKGRKGPLSSILR | Sequential / Linear | 510-540 | - | 181434 | IgE from serum of soybean allergic patients | - | - | Major epitope | Dot-blot inhibition assay | 23454299 | - |
Gly m 5 | Gly m 5.0101 | LRRHKNKNPFLFGSNRFE | Sequential / Linear | 125-142 | - | - | Alpha casein-specific mAb 1D5 | - | - | - | Dot blot, MALDI-TOF MS | 28643898 | Bos d 9 cross-reactive epitope |
Gly m 5 | Gly m 5.0101 | KNPQLRDLDIFLSIVDMNE | Sequential / Linear | 367-385 | - | - | Alpha casein-specific mAb 1D5 | - | - | - | Dot blot, MALDI-TOF MS | 28643898 | Bos d 9 cross-reactive epitope |
Gly m 5 | Gly m 5.0101 | GNKGRKGPLSSILRAFY | Sequential / Linear | 527-543 | - | - | Alpha casein-specific mAb 1D5 | - | - | - | Dot blot, MALDI-TOF MS | 28643898 | Bos d 9 cross-reactive epitope |
Gly m 5 | Gly m 5.0301 | GRIRLLQRFNKRSPQLENLRDYR | Sequential / Linear | 51-73 | 1UIJ 1IPJ 1IPK
| - | Sera from soybean allergic patients | - | - | - | ELISA | 32198043 | Also an IgG-binding epitope |
Gly m 5 | Gly m 5.0301 | LSRRAKSSSRKTISSEDEPFNLRSRNPIYS | Sequential / Linear | 221-250 | 1UIJ 1IPJ 1IPK
| - | Sera from soybean allergic patients | - | - | - | ELISA | 32198043 | Also an IgG-binding epitope |
Gly m 5 | Gly m 5.0101 | QLQNLRDYRILEFNSKPNT | Sequential / Linear | 164-182 | - | 1387227 | Sera from infants allergic to Cow Milk or mice mAbs | - | - | - | Western / Immunoblot | 32896409 | Bos d 9 IgE and IgG cross-reactive epitope |
Gly m 5 | Gly m 5.0101 | KEQIRALSKRAKSSSRKTISSED | Sequential / Linear | 319-341 | - | 1383331 | Sera from infants allergic to Cow Milk or mice mAbs | - | - | - | Western / Immunoblot | 32896409 | Bos d 9 IgE and IgG cross-reactive epitope |