![]() |
Database of 2313 Experimentally Validated Allergens |
![]() |
![]() |
Database of 2313 Experimentally Validated Allergens |
AllerBase ID | AB_A_02044 | Allergen Name | Exo m 1 |
Source Organism | Exopalaemon modestus (White legged freshwater shrimp) | Kingdom | Animal |
Biological Function/Role | Muscle contraction protein | Mode of Exposure | Ingestion |
Biological assay / test | IgE assay / test | Physicochemical test | Cell-based assay |
Basophil/Mast cell/Histamine Test ![]() | EAST ![]() | Chromatography ![]() | Lymphocyte proliferation assay ![]() |
Bronchial Test ![]() | ELISA ![]() | Isoelectrofocusing ![]() | |
Conjunctival Test ![]() | Crossed immunoelectrophoresis ![]() | Mass spectrometry (MS) ![]() | |
Nasal Test ![]() | Fluorescence Immunoassay ![]() | N-terminal sequencing/sequence analysis ![]() | |
Oral Test ![]() | Immunochemiluminescent assay ![]() | ||
Passive Cutaneous Anaphylaxis (PCA) ![]() | ImmunoCAP Test ![]() | ||
Skin Test ![]() | Microarray ![]() | ||
Radio Immunoassay ![]() | |||
RAST ![]() | |||
Western/Immunoblot ![]() |
Isoallergen/Variant for Exo m 1: | Available |
Isoallergen/Variant | Common Name | GenBank Nucleotide | NCBI Protein (GenPept) | UniProtKB | RCSB-PDB (Click on the PDB id to view structure) | ETR (Evolutionary Trace analysis Report) |
Exo m 1.0101 | Tropomyosin |
|
IUIS | IUIS-Allergen |
Allergome | 12185 |
AllFam | - |
Allergen | Isoallergen / Isoform | Epitope | Type of Epitope | Sequence Position | View on Structure | IEDB | Antibody Used | IMGT | AgAbDb Link | Nature of Epitope | Assay | Reference | Comment |
Exo m 1 | Exo m 1.0101 | VHNLQKRMQQLENDLDS | Sequential / Linear | 43-59 | - | 956741 | Sera from Shrimp allergic patients | - | - | - | Dot blot | 31707198 | - |
Exo m 1 | Exo m 1.0101 | VAALNRRIQLLEEDLERSEER | Sequential / Linear | 85-105 | - | 956737 | Sera from Shrimp allergic patients | - | - | - | Dot blot | 31707198 | - |
Exo m 1 | Exo m 1.0101 | ENRSLSDEERMDALENQLKEARFLAEEADRKYDE | Sequential / Linear | 131-164 | - | 956549 | Sera from Shrimp allergic patients | - | - | - | Dot blot | 31707198 | - |
Exo m 1 | Exo m 1.0101 | ESKIVELEEELRVVG | Sequential / Linear | 187-201 | - | 14183 | Sera from Shrimp allergic patients | - | - | - | Dot blot | 31707198 | - |
Exo m 1 | Exo m 1.0101 | ERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSE | Sequential / Linear | 243-280 | - | 956552 | Sera from Shrimp allergic patients | - | - | - | Dot blot | 31707198 | - |
No IgE Antibody Data Available |
No Cross-Reactivity Data Available |