![]() |
Database of 2313 Experimentally Validated Allergens |
![]() |
![]() |
Database of 2313 Experimentally Validated Allergens |
AllerBase ID | AB_A_00726 | Allergen Name | Der p 7 |
Source Organism | Dermatophagoides pteronyssinus (European house dust mite) | Kingdom | Animal |
Biological Function/Role | Unknown | Mode of Exposure | Inhalation |
Biological assay / test | IgE assay / test | Physicochemical test | Cell-based assay |
Basophil/Mast cell/Histamine Test ![]() | EAST ![]() | Chromatography ![]() | Lymphocyte proliferation assay ![]() |
Bronchial Test ![]() | ELISA ![]() | Isoelectrofocusing ![]() | |
Conjunctival Test ![]() | Crossed immunoelectrophoresis ![]() | Mass spectrometry (MS) ![]() | |
Nasal Test ![]() | Fluorescence Immunoassay ![]() | N-terminal sequencing/sequence analysis ![]() | |
Oral Test ![]() | Immunochemiluminescent assay ![]() | ||
Passive Cutaneous Anaphylaxis (PCA) ![]() | ImmunoCAP Test ![]() | ||
Skin Test ![]() | Microarray ![]() | ||
Radio Immunoassay ![]() | |||
RAST ![]() | |||
Western/Immunoblot ![]() |
Isoallergen/Variant for Der p 7: | Available |
Isoallergen/Variant | Common Name | GenBank Nucleotide | NCBI Protein (GenPept) | UniProtKB | RCSB-PDB (Click on the PDB id to view structure) | ETR (Evolutionary Trace analysis Report) |
Der p 7.0101 | Mite allergen Der p 7 |
|
IUIS | IUIS-Allergen |
Allergome | 321 |
AllFam | AF195 |
Allergen | Isoallergen / Isoform | Epitope | Type of Epitope | Sequence Position | View on Structure | IEDB | Antibody Used | IMGT | AgAbDb Link | Nature of Epitope | Assay | Reference | Comment |
Der p 7 | Der p 7.0101 | S173;175LDP177 | Discontinuous/ Conformational | 173;175-177 | 3H4Z | 188007 | Mouse monoclonal antibody (MoAb) WH9 that inhibits IgE-binding | - | - | - | Site-directed mutagenesis with Western / Immunoblot | 23940735 | L175, D176 critical for inhibition of IgE-binding to Der p 7 |
Der p 7 | Der p 7.0101 | DPIHYDKITEEINKAVDEAVAAIEKSETFD | Sequential / Linear | 18-47 | 3H4Z | 969047 | IgE from serum of house dust mite allergic patients | - | - | - | Dot blot, antigen inhibition | 34220841 | - |
Antibody data | Allergen data |
Antibody/ Chain Description | Clone/ Isolate | Antibody Source | IMGT | NCBI Protein (GenPept) | Broad Allergen Category | Allergen Id /Name | Material used for Sensitization | Allergic Disease | Antibody studied in | Reference |
Monoclonal antibody WH9 heavy chain | - | Mus musculus | KC222648 | AGT38394.1 | Respiratory | Der p 7 | House dust mite | Not specified | Not specified | 23940735 |
Monoclonal antibody WH9 light chain | - | Mus musculus | KC222649 | AGT38395.1 | Respiratory | Der p 7 | House dust mite | Not specified | Not specified | 23940735 |
Allergen | Cross-reactive Allergens | Reference |
Der p 7 | Blo t 7 (View AllerBase Entry) | 29356186 |
Der p 7 | Der f 7 (View AllerBase Entry) | 9249276 |