AllerBase Allergen Database

Data for Der f 24

WHO/IUIS recognized Allergen

1 1 1 0 1 0 1 0 0

Completeness Index: Denotes availibility of data for the allergen in Binary format
1: data available
0: data not available

(Read More)

AllerBase ID	AB_A_00684	Allergen Name	Der f 24
Source Organism	Dermatophagoides farinae (American house dust mite)	Kingdom	Animal
Biological Function/Role	Cytochrome complex	Mode of Exposure	Inhalation

Assays/Methods used for Experimental Characterization (Read More)

: Data Available

: Data not Available

Biological assay / test	IgE assay / test	Physicochemical test	Cell-based assay
Basophil/Mast cell/Histamine Test (Reference/s)	EAST	Chromatography (Reference/s)	Lymphocyte proliferation assay
Bronchial Test	ELISA (Reference/s)	Isoelectrofocusing
Conjunctival Test	Crossed immunoelectrophoresis	Mass spectrometry (MS) (Reference/s)
Nasal Test	Fluorescence Immunoassay	N-terminal sequencing/sequence analysis
Oral Test	Immunochemiluminescent assay
Passive Cutaneous Anaphylaxis (PCA)	ImmunoCAP Test
Skin Test (Reference/s)	Microarray
	Radio Immunoassay
	RAST
	Western/Immunoblot (Reference/s)

Isoallergen/Variant for Der f 24:

Available

Isoallergen/Variant	Common Name	GenBank Nucleotide	NCBI Protein (GenPept)	UniProtKB	RCSB-PDB (Click on the PDB id to view structure)	ETR (Evolutionary Trace analysis Report)
Der f 24.0101	Ubiquinol-cytochrome c reductase binding protein	KC669700.1 (View Sequence)	AGI78542.1 (View Sequence)	M9RZ95 (View Sequence)	-	-

Sequence Analysis

BLAST Nucleotide/Protein sequence of Allergen Der f 24 with Nucleotide or Protein sequences in AllerBase:
Select GenBank or UniprotKB accession number by clicking on the checkbox in the above table

Default E-value cut-off for BLAST is set at 0.01.

OR
Set E-value of your choice:
Align Nucleotode/Protein sequence of Your choice with Nucleotode or Protein sequence of Allergen Der f 24: (Alignment job will be redirected to EMBL-EMBOSS Water or Needle tool)

*

*Input your Nucleotode or Protein sequence (in FASTA format) here:

Cross-links to Allergen Databases

IgE Epitope Data

Allergen

Isoallergen / Isoform

Epitope

Type of Epitope

Sequence Position

View on Structure

IEDB

Antibody Used

IMGT

AgAbDb Link

Nature of Epitope

Assay

Reference

Comment

Der f 24

Der f 24.0101

MVHLTKTLRFINNPGFRKFYYGLQGYNKYGLY

Sequential / Linear

1-32

Serum from House dust mite allergic patients

Immunodominant epitope

ELISA,Dot-blot

IgE Antibody Data

No IgE Antibody Data Available

Cross-reactivity Data

No Cross-Reactivity Data Available