Allergen |
Isoallergen / Isoform |
Epitope |
Type of Epitope |
Sequence Position |
View on Structure |
IEDB |
Antibody Used |
IMGT |
AgAbDb Link |
Nature of Epitope |
Assay |
Reference |
Comment |
Bos d 10 | Bos d 10.0101 | YQKFALPQYL | Sequential / Linear | 186-195 | - | 75506 | IgE from serum of patients with persistent cow's milk allergy | - | - | - | Western / Immunoblot | 12170271 | - |
Bos d 10 | Bos d 10.0101 | NEINQFYQKFPQYLQYLY | Sequential / Linear | 98-115 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Major epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | STEVFTKKTKLTEEEK | Sequential / Linear | 158-173 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Major epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | EKNRLNFLKKISQRYQ | Sequential / Linear | 172-187 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Major epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | KKISQRYQKFALPQYLKTVYQHQK | Sequential / Linear | 180-203 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Major epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | SKENLCSTFCKEVV | Sequential / Linear | 46-59 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Minor epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | VVRNANEEEYSIGS | Sequential / Linear | 58-71 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Minor epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | PQYLQYLYQGPIVL | Sequential / Linear | 108-121 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Minor epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | VLNPWDQVKR | Sequential / Linear | 120-129 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Minor epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | VPITPTLNREQL | Sequential / Linear | 132-143 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Minor epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | KPWIQPKTKV | Sequential / Linear | 206-215 | - | - | Serum from patients with IgE mediated cow's milk allergy and atopic dermatitis | - | - | Minor epitope | Western / Immunoblot | 12373003 | - |
Bos d 10 | Bos d 10.0101 | KNTMEHVSSSEESIISQETYKQEKNMAINPSK | Sequential / Linear | 16-47 | - | 78187 | IgE from serum of patients with cow's milk allergy | - | - | - | Microarray | 18774394 | - |
Bos d 10 | Bos d 10.0101 | EEVKITVDDKHYQKALNEIN | Sequential / Linear | 82-101 | - | 78138 | IgE from serum of patients with cow's milk allergy | - | - | - | Microarray | 18774394 | - |
Bos d 10 | Bos d 10.0101 | KTVYQHQKAMKPWIQPKTKVIPYVRYL | Sequential / Linear | 196-222 | - | 78189 | IgE from serum of patients with cow's milk allergy | - | - | - | Microarray | 18774394 | - |
Bos d 10 | Bos d 10.0101 | NMAINPSK | Sequential / Linear | 40-47 | - | - | Serum of cow milk-allergic patients | - | - | - | Dot blot | 36307246 | - |