![]() |
Database of 2313 Experimentally Validated Allergens |
![]() |
![]() |
Database of 2313 Experimentally Validated Allergens |
AllerBase ID | AB_F_00209 | Allergen Name | Asp f 13 |
Source Organism | Aspergillus fumigatus () | Kingdom | Fungi |
Biological Function/Role | Serine protease | Mode of Exposure | Inhalation |
Biological assay / test | IgE assay / test | Physicochemical test | Cell-based assay |
Basophil/Mast cell/Histamine Test ![]() | EAST ![]() | Chromatography ![]() | Lymphocyte proliferation assay ![]() |
Bronchial Test ![]() | ELISA ![]() | Isoelectrofocusing ![]() | |
Conjunctival Test ![]() | Crossed immunoelectrophoresis ![]() | Mass spectrometry (MS) ![]() | |
Nasal Test ![]() | Fluorescence Immunoassay ![]() | N-terminal sequencing/sequence analysis ![]() | |
Oral Test ![]() | Immunochemiluminescent assay ![]() | ||
Passive Cutaneous Anaphylaxis (PCA) ![]() | ImmunoCAP Test ![]() | ||
Skin Test ![]() | Microarray ![]() | ||
Radio Immunoassay ![]() | |||
RAST ![]() | |||
Western/Immunoblot ![]() |
Isoallergen/Variant for Asp f 13: | Available |
Isoallergen/Variant | Common Name | GenBank Nucleotide | NCBI Protein (GenPept) | UniProtKB | RCSB-PDB (Click on the PDB id to view structure) | ETR (Evolutionary Trace analysis Report) |
Asp f 13.0101 | Alkaline protease 1 |
|
IUIS | IUIS-Allergen |
Allergome | 66 |
AllFam | AF021 |
Allergen | Isoallergen / Isoform | Epitope | Type of Epitope | Sequence Position | View on Structure | IEDB | Antibody Used | IMGT | AgAbDb Link | Nature of Epitope | Assay | Reference | Comment |
Asp f 13 | Asp f 13.0101 | NSDASNTSPASAPNALTVAAINKSNARASFSNYGSVVD | Sequential / Linear | 286-323 | - | 45775 | IgE from serum of patients allergic to A. fumigatus | - | - | Immunodominant epitope | Dot-blot, N-terminal sequencing and mass spectrometry | 10677362 | - |
Asp f 13 | Asp f 13.0101 | IFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSVYLMGLENLSGPAAVTARIKE | Sequential / Linear | 324-380 | - | - | IgE from serum of patients allergic to A. fumigatus | - | - | Immunodominant epitope | Dot-blot, N-terminal sequencing and mass spectrometry | 10677362 | - |
Asp f 13 | Asp f 13.0101 | GLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNGNA | Sequential / Linear | 364-403 | - | 20819 | IgE from serum of patients allergic to A. fumigatus | - | - | Immunodominant epitope | Dot-blot, N-terminal sequencing and mass spectrometry | 10677362 | - |
No IgE Antibody Data Available |
Allergen | Cross-reactive Allergens | Reference |
Asp f 13 | Asp fl 13 (View AllerBase Entry) Pen c 13 (View AllerBase Entry) | 10474033 |