![]() |
Database of 2313 Experimentally Validated Allergens |
![]() |
![]() |
Database of 2313 Experimentally Validated Allergens |
AllerBase ID | AB_P_00180 | Allergen Name | Ara h PNA |
Source Organism | Arachis hypogaea (Peanut) | Kingdom | Plant |
Biological Function/Role | Agglutinin | Mode of Exposure | Ingestion |
Biological assay / test | IgE assay / test | Physicochemical test | Cell-based assay |
Basophil/Mast cell/Histamine Test ![]() | EAST ![]() | Chromatography ![]() | Lymphocyte proliferation assay ![]() |
Bronchial Test ![]() | ELISA ![]() | Isoelectrofocusing ![]() | |
Conjunctival Test ![]() | Crossed immunoelectrophoresis ![]() | Mass spectrometry (MS) ![]() | |
Nasal Test ![]() | Fluorescence Immunoassay ![]() | N-terminal sequencing/sequence analysis ![]() | |
Oral Test ![]() | Immunochemiluminescent assay ![]() | ||
Passive Cutaneous Anaphylaxis (PCA) ![]() | ImmunoCAP Test ![]() | ||
Skin Test ![]() | Microarray ![]() | ||
Radio Immunoassay ![]() | |||
RAST ![]() | |||
Western/Immunoblot ![]() |
Isoallergen/Variant for Ara h PNA: | Not Available |
Allergen | Common Name | GenBank Nucleotide | NCBI Protein (GenPept) | UniProtKB | RCSB-PDB (Click on the PDB id to view structure) | ETR (Evolutionary Trace analysis Report) |
Ara h PNA | Galactose-binding lectin |
|
IUIS | - |
Allergome | 1050 |
AllFam | AF034 |
Allergen | Isoallergen / Isoform | Epitope | Type of Epitope | Sequence Position | View on Structure | IEDB | Antibody Used | IMGT | AgAbDb Link | Nature of Epitope | Assay | Reference | Comment |
Ara h PNA | - | NIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVA | Sequential / Linear | 54-86 | 1BZW 1CIW 1CQ9 1CR7 1QF3 1RIR 1RIT 1V6I 1V6J 1V6K 1V6L 1V6M 1V6N 1V6O 2DH1 2DV9 2DVA 2DVB 2DVD 2DVF 2DVG 2PEL 2TEP | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Ara h PNA | - | LGVSDTKGA | Sequential / Linear | 129-137 | 1BZW 1CIW 1CQ9 1CR7 1QF3 1RIR 1RIT 1V6I 1V6J 1V6K 1V6L 1V6M 1V6N 1V6O 2DH1 2DV9 2DVA 2DVB 2DVD 2DVF 2DVG 2PEL 2TEP | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Ara h PNA | - | VDSVKTVPWNSVSGA | Sequential / Linear | 168-182 | 1BZW 1CIW 1CQ9 1CR7 1QF3 1RIR 1RIT 1V6I 1V6J 1V6K 1V6L 1V6M 1V6N 1V6O 2DH1 2DV9 2DVA 2DVB 2DVD 2DVF 2DVG 2PEL 2TEP | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Ara h PNA | - | IYDSSTKTL | Sequential / Linear | 189-197 | 1BZW 1CIW 1CQ9 1CR7 1QF3 1RIR 1RIT 1V6I 1V6J 1V6K 1V6L 1V6M 1V6N 1V6O 2DH1 2DV9 2DVA 2DVB 2DVD 2DVF 2DVG 2PEL 2TEP | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Ara h PNA | - | QVVDLKAKLPERVKF | Sequential / Linear | 213-227 | 1BZW 1CIW 1CQ9 1CR7 1QF3 1RIR 1RIT 1V6I 1V6J 1V6K 1V6L 1V6M 1V6N 1V6O 2DH1 2DV9 2DVA 2DVB 2DVD 2DVF 2DVG 2PEL 2TEP | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
Ara h PNA | - | ASGSLGGRQIHLIRSWSFTSTLITT | Sequential / Linear | 231-255 | 1BZW 1CIW 1CQ9 1CR7 1QF3 1RIR 1RIT 1V6I 1V6J 1V6K 1V6L 1V6M 1V6N 1V6O 2DH1 2DV9 2DVA 2DVB 2DVD 2DVF 2DVG 2PEL 2TEP | - | IgE from serum of peanut-allergic patients | - | - | - | Western / Immunoblot | 20541807 | - |
No IgE Antibody Data Available |
Allergen | Cross-reactive Allergens | Reference |
Ara h PNA | Gly m SBA (View AllerBase Entry) Lat oc LEC (View AllerBase Entry) Len c LcA (View AllerBase Entry) Pha v PHA-E (View AllerBase Entry) Pis s PsA (View AllerBase Entry) | 20541807 |