Biological assay / test |
IgE assay / test |
Physicochemical test |
Cell-based assay |
Basophil/Mast cell/Histamine Test (Reference/s) | EAST  | Chromatography (Reference/s) | Lymphocyte proliferation assay  |
Bronchial Test  | ELISA (Reference/s) | Isoelectrofocusing  | |
Conjunctival Test  | Crossed immunoelectrophoresis  | Mass spectrometry (MS) (Reference/s) | |
Nasal Test  | Fluorescence Immunoassay (Reference/s) | N-terminal sequencing/sequence analysis (Reference/s) | |
Oral Test  | Immunochemiluminescent assay  | | |
Passive Cutaneous Anaphylaxis (PCA)  | ImmunoCAP Test (Reference/s) | | |
Skin Test  | Microarray  | | |
| Radio Immunoassay  | | |
| RAST  | | |
| Western/Immunoblot (Reference/s) | | |
Allergen |
Isoallergen / Isoform |
Epitope |
Type of Epitope |
Sequence Position |
View on Structure |
IEDB |
Antibody Used |
IMGT |
AgAbDb Link |
Nature of Epitope |
Assay |
Reference |
Comment |
Ana o 3 | Ana o 3.0101 | SGREQSCQRQFE | Sequential / Linear | 33-44 | - | 58215 | IgE from serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | KQEVQRGGRYNQ | Sequential / Linear | 57-68 | - | 32975 | IgE from serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | SLRECCQELQEV | Sequential / Linear | 72-83 | - | 59430 | IgE from serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | QEQIKGEEVREL | Sequential / Linear | 102-113 | - | 50677 | IgE from serum of cashew allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | CQRQFEEQQRFR | Sequential / Linear | 39-50 | - | 6897 | IgE from serum of cashew allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | RYVKQEVQRGGR | Sequential / Linear | 54-65 | - | 56675 | IgE from serum of cashew allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | LQQQEQIKGEEV | Sequential / Linear | 99-110 | - | 38962 | IgE from serum of cashew allergic patients | - | - | Moderately reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | QFEEQQRFRNCQ | Sequential / Linear | 42-53 | - | 50752 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | EQQRFRNCQRYV | Sequential / Linear | 45-56 | - | 13911 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | RFRNCQRYVKQE | Sequential / Linear | 48-59 | - | 53773 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | YNQRQESLRECC | Sequential / Linear | 66-77 | - | 75208 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | RQESLRECCQEL | Sequential / Linear | 69-80 | - | 55412 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | ECCQELQEVDRR | Sequential / Linear | 75-86 | - | 11234 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | QELQEVDRRCRC | Sequential / Linear | 78-89 | - | 50648 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | IKGEEVRELYET | Sequential / Linear | 105-116 | - | 26794 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | ICSISPSQGCQF | Sequential / Linear | 123-134 | - | 25525 | IgE from serum of cashew allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 15940148 | - |
Ana o 3 | Ana o 3.0101 | AFAVLLLVANASIYRAIVEVE | Sequential / Linear | 10-30 | - | - | IgE from cashew and tree-nut allergic patients | - | - | Weakly reacting epitope | Western / Immunoblot | 26769082 | - |
Ana o 3 | Ana o 3.0101 | RCRCQNLEQMVRQLQQQEQIKGE | Sequential / Linear | 85-108 | - | - | IgE from cashew and tree-nut allergic patients | - | - | Strongly reacting epitope | Western / Immunoblot | 26769082 | - |
Ana o 3 | Ana o 3.0101 | AFAVLLLVANASIYR | Sequential / Linear | 10-24 | - | 2186631 | IgE from pooled serum of cashew allergic patients | - | - | - | Phage ELISA | 36838874 | - |
Ana o 3 | Ana o 3.0101 | VLLLVANASIYRAIV | Sequential / Linear | 13-27 | - | 2187257 | IgE from pooled serum of cashew allergic patients | - | - | - | Phage ELISA | 36838874 | - |
Ana o 3 | Ana o 3.0101 | QRQFEEQQR | Sequential / Linear | 39-48 | - | 2187082 | IgE from pooled serum of cashew allergic patients | - | - | - | Phage ELISA | 36838874 | - |
Ana o 3 | Ana o 3.0101 | YNQRQE | Sequential / Linear | 66-71 | - | 2187298 | IgE from pooled serum of cashew allergic patients | - | - | - | Phage ELISA | 36838874 | - |
Ana o 3 | Ana o 3.0101 | QQEQIKG | Sequential / Linear | 101-107 | - | 2187079 | IgE from pooled serum of cashew allergic patients | - | - | - | Phage ELISA | 36838874 | - |
Ana o 3 | Ana o 3.0101 | EEVRELYE | Sequential / Linear | 108-115 | - | 2186756 | IgE from pooled serum of cashew allergic patients | - | - | - | Phage ELISA | 36838874 | - |
Ana o 3 | Ana o 3.0101 | TASELPRI | Sequential / Linear | 116-123 | - | 2187174 | IgE from pooled serum of cashew allergic patients | - | - | - | Phage ELISA | 36838874 | - |
Ana o 3 | Ana o 3.0101 | CQRQFEEQQRFRNCQRYVKQEVQRGGRYNQRQE | Sequential / Linear | 39-71 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 1 |
Ana o 3 | Ana o 3.0101 | SLRECCQELQEVDRRCR | Sequential / Linear | 72-88 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 1 |
Ana o 3 | Ana o 3.0101 | CQNLEQMVRQLQQQEQ | Sequential / Linear | 89-104 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 1 |
Ana o 3 | Ana o 3.0101 | YETASELPRICSISPSQG | Sequential / Linear | 114-131 | - | - | IgE from serum of patients allergic to pistachio and cashew | - | - | - | SPOT assay | DOI:10.3390/allergies1010006 | Similar epitope to Pis v 1 |