View Epitope

PDB Id: 4BG4    Crystal structure of Litopenaeus vannamei arginine kinase in a ternary analog complex with arginine

Structure Resolution: 1.6

Allergen/Isoallergen: Lit v 2.0101

Epitope: EGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGD

Sequence Position: 160-192