View Epitope

PDB Id: 2TEP    PEANUT LECTIN COMPLEXED WITH T-ANTIGENIC DISACCHARIDE

Structure Resolution: 2.5

Allergen/Isoallergen: Ara h PNA

Epitope: NIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVA

Sequence Position: 54-86