View Epitope

PDB Id: 2PEL    PEANUT LECTIN

Structure Resolution: 2.25

Allergen/Isoallergen: Ara h PNA

Epitope: NIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVA

Sequence Position: 54-86