View Epitope

PDB Id: 2DH1    Crystal structure of peanut lectin lactose-azobenzene-4

Structure Resolution: 4'-dicarboxylic acid-lactose complex

Allergen/Isoallergen: Ara h PNA

Epitope: NIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVA

Sequence Position: 7.65