View Epitope

PDB Id: 1V6O    Peanut lectin complexed with 10mer peptide (PVRIWSSATG)

Structure Resolution: 3.0

Allergen/Isoallergen: Ara h PNA

Epitope: NIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVA

Sequence Position: 54-86