View Epitope

PDB Id: 1V6K    Peanut lectin-lactose complex in the presence of peptide(IWSSAGNVA)

Structure Resolution: 2.4

Allergen/Isoallergen: Ara h PNA

Epitope: NIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVA

Sequence Position: 54-86