View Epitope

PDB Id: 1RIT    Crystal structure of Peanut lectin in complex with meso-tetrasulphonatophenylporphyrin and lactose

Structure Resolution: 2.85

Allergen/Isoallergen: Ara h PNA

Epitope: NIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVA

Sequence Position: 54-86