View Epitope

PDB Id: 1RIR    Crystal structure of meso-tetrasulphonatophenylporphyrin in complex with Peanut lectin.

Structure Resolution: 2.9

Allergen/Isoallergen: Ara h PNA

Epitope: NIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVA

Sequence Position: 54-86