View Epitope

PDB Id: 1CR7    PEANUT LECTIN-LACTOSE COMPLEX MONOCLINIC FORM

Structure Resolution: 2.6

Allergen/Isoallergen: Ara h PNA

Epitope: NIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVA

Sequence Position: 54-86