View Epitope

PDB Id: 1CIW    PEANUT LECTIN COMPLEXED WITH N-ACETYLLACTOSAMINE

Structure Resolution: 2.7

Allergen/Isoallergen: Ara h PNA

Epitope: NIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVA

Sequence Position: 54-86